KEGG   Natronorubrum bangense: DV706_12990Help
Entry
DV706_12990       CDS       T05942                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
nbg  Natronorubrum bangense
Pathway
nbg00630  Glyoxylate and dicarboxylate metabolism
nbg00660  C5-Branched dibasic acid metabolism
nbg01100  Metabolic pathways
nbg01120  Microbial metabolism in diverse environments
nbg01200  Carbon metabolism
Module
nbg_M00740  Methylaspartate cycle
Brite
KEGG Orthology (KO) [BR:nbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DV706_12990
   00660 C5-Branched dibasic acid metabolism
    DV706_12990
Enzymes [BR:nbg01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     DV706_12990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C MR_MLE_N ASL_C2
Motif
Other DBs
NCBI-ProteinID: QCC55301
UniProt: A0A4D6HP22
Position
complement(2583631..2584905)
Genome map
AA seq 424 aa AA seqDB search
MNITGIYATPGYSGFFFDDQRAIKQGAEHDGFTYVGEPVTEGFDEIRQAGESIIVDIELE
DGTVVRGDCTAVQYSGAGGRDPLFKAEEYAPVIEGPVADELVGRDATDFLDNAETLEEME
VEGDRLHTAIRYGVSQALLAAAAEAEQTTQTDVMADALGTEPATEPVPVFGQSGDDRYNN
TEKMFVKGVPVLPHALINSVEKIGENGETLLEYVEWLVERSQELGPDDYDPRFHIDVYGM
IGEIFDGPYDRDEVVDYFAALEEAAAPYPLQIEGPMDVGNREDQIAAMVELREGLEAAGV
DVDIVADEWCNTFEDVQAFVDAGAADLVQIKTPDLGGIHRSGQAVRYCEGTDTRAYLGGT
CNETETSARACAHVALATDAAQTLAKPGMGFDEGYMIVENEMRRTIARRERDQQTETDEI
TADD
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatattacaggcatatacgcaacgcccggctactccgggttcttcttcgacgaccag
cgcgcgatcaagcaaggtgccgaacacgacggcttcacctacgtgggcgagcccgtcacc
gagggcttcgacgaaatccgacaagccggcgagtcgatcatcgtcgacatcgaactcgag
gacggcaccgtcgtccgcggtgactgtaccgccgtccagtactccggtgccggcgggcgt
gatccgctgttcaaagccgaggagtacgctcccgttatcgagggccctgttgccgacgaa
ctcgtcggccgcgatgcgaccgacttcctcgacaacgctgagacgctcgaggagatggaa
gtcgagggcgaccgtctgcacacggcgatccgatacggtgtttcccaggcgctgctcgcc
gcagccgccgaagccgaacagaccacgcagacagacgtgatggccgatgcactcggtacg
gagccggcaaccgaaccggtgcccgtcttcggccagtccggtgacgaccgctacaacaac
actgagaagatgttcgtcaagggcgttcccgtcctgccccacgcgctcatcaacagcgtc
gagaagatcggcgaaaacggcgagaccttactcgagtacgtcgagtggctcgtcgagcga
tctcaggagctcggccccgacgactacgatccccgattccacatcgacgtctacggcatg
atcggagagatcttcgacggtccctatgaccgcgacgaagtggtcgactacttcgccgcc
ttagaggaggccgccgcgccgtacccgcttcagatcgaggggccgatggacgttggcaac
cgagaagatcagatcgcagcgatggtcgaacttcgcgagggactcgaggcggccggtgtc
gatgtcgacatcgtcgccgacgagtggtgtaacaccttcgaggacgtccaagcgttcgtc
gacgccggcgcagccgacctcgtgcagatcaaaactcccgaccttggtggcattcaccgg
agcggacaggcagttcgctactgtgaggggaccgacacccgtgcctatctcggcgggacc
tgcaacgaaacggaaacctctgcgcgtgcctgtgcccacgtcgccctcgcgacggacgcc
gcacagacactcgcaaagcccggtatgggcttcgacgagggctacatgatcgtcgaaaac
gagatgcgacgcacgatcgcacgccgcgagcgagaccaacagaccgagactgacgagatt
actgcagatgactga

DBGET integrated database retrieval system