KEGG   Natronorubrum bangense: DV706_17910Help
Entry
DV706_17910       CDS       T05942                                 

Definition
(GenBank) malate synthase
  KO
K19282  bifunctional (S)-malyl-CoA lyase/thioesterase [EC:4.1.3.24 3.1.2.30]
Organism
nbg  Natronorubrum bangense
Pathway
nbg00630  Glyoxylate and dicarboxylate metabolism
nbg01100  Metabolic pathways
nbg01120  Microbial metabolism in diverse environments
nbg01200  Carbon metabolism
Module
nbg_M00740  Methylaspartate cycle
Brite
KEGG Orthology (KO) [BR:nbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DV706_17910
Enzymes [BR:nbg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.30  (3S)-malyl-CoA thioesterase
     DV706_17910
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     DV706_17910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: QCC56403
UniProt: A0A4D6HRA9
Position
unnamed1:complement(500753..502063)
Genome map
AA seq 436 aa AA seqDB search
MSTHTDRLHDRKFVRTFFTTPTAVEGEDDSAKMLRSAAQLRGMEAPDVWVPDNEDATAPS
MRDEGIENIIDVISEHGADYPSEIHPRMVWHRDSPATRYQGFQHIMELADPENGAIEHID
GVVIPEVGDIDDWKKADEFITIVENEHGLEEGSLAMSVIVESGEAELALGDLREEMGKPA
NNLERLFLLVDGEVDYTKNMRAITPTGELPPWPELRHNTSRGASAAGLIAVDGPYDDIRD
VEGYHERMTDNQAKGMLGIWSLTPGQVVEANKSPLPPKTGSWLLEANGREVELDEEDGQF
VYEGDGIELDETGDDQYRLRIGSNERDLDGDELSEALLDLASYIPSLNDIVDSMEEFEAA
KEAGKGAIAMERAATLVIDGVEVEISNDRMWDEATYQAAQTPINLFQDVYENRPDQHEDL
EELYGEDIVERAIVVG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcataccgaccgtctccacgaccggaagttcgtgcggacgttctttaccact
ccaacagcagtggaaggagaagacgattctgccaagatgcttcgcagtgccgcccaactc
cgcggaatggaagccccggacgtctgggtcccggacaacgaagatgcaaccgctccttcg
atgcgtgatgaaggaatcgagaacatcatcgatgtgatttcggagcacggcgccgactac
cccagcgagatccacccccgtatggtctggcacagggacagcccagccaccagatatcaa
ggattccagcacatcatggaactcgccgacccggaaaacggagccatcgagcacattgac
ggtgtcgtgatcccggaagtcggcgacatcgacgactggaagaaggccgacgagttcatc
accatcgtcgaaaacgagcacggactggaagaaggcagtctagccatgtcggtcatcgtc
gaaagcggcgaggctgaactggcactcggggacctccgtgaggagatgggcaagcccgca
aacaacctcgagcgtctgtttcttctcgtggacggcgaagtggactacaccaagaacatg
cgagcgatcacacccaccggagaactcccgccgtggccggagctgcgacacaacacctct
cgcggtgcgagcgcggccggcctgatcgccgtcgacggaccgtacgacgacatccgtgac
gttgagggctatcacgagcgcatgaccgacaatcaggcgaaaggcatgctcggtatctgg
tcgctaacccccggacaagtagtggaagcgaacaaatcgccgctaccaccgaagaccggc
agctggctcctcgaggccaacggccgcgaggttgaactcgacgaagaagatggtcagttc
gtgtacgagggtgacggaatcgaactcgacgagacaggcgatgaccagtatcgactccgc
atcggcagcaacgaacgcgacctcgacggagacgagctgtccgaagcgttgctggaccta
gcgtcgtatatcccgagtctgaacgacatcgtcgactcgatggaggagttcgaagcggcc
aaggaagctggaaaaggtgcgatcgccatggaacgggcggcgacactggtcatcgacggg
gtcgaagtcgagatcagcaacgaccgaatgtgggacgaagcgacctatcaggcagcccag
acgcccatcaatctgttccaggacgtctacgagaaccgtccagatcagcacgaggacctc
gaggaactgtacggtgaggatatcgtcgaacgcgcaatagtcgttgggtga

DBGET integrated database retrieval system