KEGG   Natronorubrum bangense: DV706_19720Help
Entry
DV706_19720       CDS       T05942                                 

Definition
(GenBank) haloacid dehalogenase type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
nbg  Natronorubrum bangense
Pathway
nbg00625  Chloroalkane and chloroalkene degradation
nbg01100  Metabolic pathways
nbg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nbg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DV706_19720
   00361 Chlorocyclohexane and chlorobenzene degradation
    DV706_19720
Enzymes [BR:nbg01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     DV706_19720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: QCC56771
UniProt: A0A4D6HT88
Position
unnamed2:complement(39540..40229)
Genome map
AA seq 229 aa AA seqDB search
MSFDPTAVETITVDSYGTLVDPAAVETALETAIDAEHAQSISDQWRSRSLMYTMVSNFTD
SYQPFYDMNRDALRVSLADHGVDLSSATIEDILSAYHDLDPFEDVRRGLEAVTDAGYEVF
VLSNGNPAMLESMVETAALESVLSGTISAHEIRTFKPDADIYRHAAAQTETPLESIAHVA
GPTFDVQGSMHAGMQGVWINRTDGLWDPFAAEPDLTVETFDEFATELGV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgacccaaccgccgttgaaacgatcactgtcgactcgtatggaaccctcgtc
gaccctgctgccgttgaaacggcgctcgagacagctatcgacgccgagcatgcacagtcc
atttccgatcagtggcgaagtcgctcgctcatgtatacgatggtgagcaacttcaccgac
agctaccagccgttttacgacatgaaccgcgatgcgcttcgagtctcgctcgcggatcat
ggtgtcgacctctcgtctgcgacaatcgaggacatcctctcagcgtaccacgaccttgac
ccgtttgaggacgtccggcgcggactcgaggccgttactgacgccggatacgaggtcttc
gtgttgtcgaacgggaatccggcgatgctcgagtcgatggtcgaaacggcggctctcgaa
tcagtactctcggggacgatcagcgcacacgagattcggacgttcaaacccgacgcagac
atctatcgacacgcggcggcgcaaacggagacaccgctcgagtcgatcgcgcacgttgcc
ggcccgacattcgacgtccaagggtcgatgcatgcgggcatgcagggagtctggatcaat
cgaacagatggtctctgggatccatttgctgccgaaccagacctgaccgtcgagacgttt
gatgagttcgcgaccgaacttggtgtgtaa

DBGET integrated database retrieval system