KEGG   Nocardia brasiliensis: O3I_001830Help
Entry
O3I_001830        CDS       T02270                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00010  Glycolysis / Gluconeogenesis
nbr00620  Pyruvate metabolism
nbr00630  Glyoxylate and dicarboxylate metabolism
nbr00640  Propanoate metabolism
nbr00680  Methane metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_001830
   00620 Pyruvate metabolism
    O3I_001830
   00630 Glyoxylate and dicarboxylate metabolism
    O3I_001830
   00640 Propanoate metabolism
    O3I_001830
  09102 Energy metabolism
   00680 Methane metabolism
    O3I_001830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nbr01004]
    O3I_001830
Enzymes [BR:nbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     O3I_001830
Lipid biosynthesis proteins [BR:nbr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   O3I_001830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFT98328
UniProt: K0EMZ4
Position
complement(419021..420973)
Genome map
AA seq 650 aa AA seqDB search
MTETADHRDSYPPAADFAAAANADAALYQRGSADRDAFWAEQADRLHWHERWNQVLDWSG
APVAKWFVGGKLNVAYNCVDRHVLDGHGDQVAIHWEGEPGDSRDITYRELLTEVSRAANY
LTELGLEAGDRVAIYMPMVPEAVVSMLACARLGLTHSVVFAGFSPTALRQRVDDAEARLI
ITTDGQWRRGKAAPLKEAVDEALYANGDVPHSVEHVLVVRRTELEVPWTDGRDLWWHETV
ANASPEHEAQAFDAEHPLFILYTSGTTGKPKGILHTSGGYLTQTAYTHHNVFDHKAGQDV
YWCTADIGWVTGHSYIVYGPLANRATQVVYEGTPNFPDEHRHWQIVEKYGVSIYYTAPTL
VRTFMKWGREIPAAHDLSSIRLLGSVGEPINPEAWRWYRDTIGAGRTPIVDTWWQTETGS
IMISPLPGVTAAKPGAAMAPLPGISALVVDEEGKPVQRGETEANGYLVLDQPWPSMLRGI
WGDMERYRATYWERYAEQGWYFAGDGAKLDADGDLWVLGRVDDVMNVSGHRISTAEVESA
LVGHSGVAEAAVVGASDETTGQGIVAFVILTAEAEDTGSALVDELKAEVSREISPIARPR
EIHVVPELPKTRSGKIMRRLLRDVAEGRELGDTSTLVDPNVFEAIRASKA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaacagccgaccacagggactcgtacccgcccgccgcggacttcgcggccgcg
gcgaacgccgatgccgcgctgtaccagcgaggttcggccgatcgcgacgcgttctgggcc
gagcaggccgatcgtttgcactggcacgagcggtggaaccaggtgctggactggtccggc
gcgccggtcgccaagtggttcgtcggcggcaagctgaacgtcgcctacaactgcgtcgac
cggcacgtgctcgacggacacggcgaccaggtcgccatccactgggagggcgagcccggc
gactcccgcgacatcacctaccgcgagctgctcaccgaggtgagccgggccgcgaactat
ctgaccgaactcggtctcgaagcgggcgaccgggtcgccatctatatgccgatggtgccc
gaggccgtcgtctcgatgctggcctgtgcgcggctcggcctcacccactcggtggtgttc
gccgggttctcccccaccgcgctgcgccaacgcgtggacgacgccgaggctcggttgatc
atcaccaccgacgggcagtggcggcgcggtaaggccgcgccgctgaaggaagccgtggac
gaggcgctgtacgcgaacggcgatgtgccgcacagcgttgagcacgtgctggtggtgcgt
cgcaccgagctcgaggtgccgtggaccgacggccgcgacctgtggtggcacgagacggtg
gcgaacgcgtcgcccgagcacgaggcgcaggccttcgacgccgagcacccgctgttcatc
ctctacacctccggcaccaccggaaaacccaagggcatcctgcacaccagcggcggctac
ctcacccagaccgcctacacccaccacaacgtcttcgatcacaaagccggacaagacgtc
tactggtgcaccgccgacatcggctgggtcaccggccacagctacatcgtctacggacca
ctggccaaccgcgccacccaggtcgtctacgagggcacgccgaacttcccggacgagcac
cggcactggcagatcgtcgaaaagtacggcgtcagtatctattacacggcaccgacactg
gtgcgtaccttcatgaagtggggtcgcgagatcccggccgcgcacgatctgtccagcatc
cggctgctcggttcggtcggtgagccgatcaacccggaggcctggcgctggtaccgcgac
accatcggcgcgggccgcaccccgatcgtggacacctggtggcagaccgagaccggctcg
atcatgatctcgccgctgcccggcgtcaccgccgccaagcccggcgcggccatggcgccg
ctgcccggcatctccgcgctggtcgtcgacgaagagggaaagccggtgcagcgcggggaa
accgaggccaacggctacctggtgctcgaccagccgtggccgtcgatgctgcgcggcatc
tggggcgacatggagcgataccgggccacgtactgggagcgctacgccgagcagggctgg
tacttcgccggggacggcgccaagctcgacgccgacggcgacctgtgggtgctcggccgg
gtcgacgacgtgatgaacgtatcgggccaccggatctccaccgccgaggtggaatcggca
ctggtcggtcactcgggggtcgccgaggccgcggtggtcggggccagcgacgagaccacc
ggccagggcatcgtcgcgttcgtcatcctgaccgcggaggccgaggacaccggcagcgcg
ctggtggacgagctgaaggcggaggtgtcgcgcgagatcagcccgatcgcgcggccgcgc
gagatccacgtggtgcccgagctgccgaagacgcgcagcggcaagatcatgcgccggttg
ctgcgcgacgtcgcggagggccgcgagctcggcgacacctcgacgctggtcgatccgaac
gtcttcgaggcgatccgggccagcaaggcgtaa

KEGG   Nocardia brasiliensis: O3I_011910Help
Entry
O3I_011910        CDS       T02270                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00010  Glycolysis / Gluconeogenesis
nbr00620  Pyruvate metabolism
nbr00630  Glyoxylate and dicarboxylate metabolism
nbr00640  Propanoate metabolism
nbr00680  Methane metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_011910
   00620 Pyruvate metabolism
    O3I_011910
   00630 Glyoxylate and dicarboxylate metabolism
    O3I_011910
   00640 Propanoate metabolism
    O3I_011910
  09102 Energy metabolism
   00680 Methane metabolism
    O3I_011910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nbr01004]
    O3I_011910
Enzymes [BR:nbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     O3I_011910
Lipid biosynthesis proteins [BR:nbr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   O3I_011910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFU00343
UniProt: K0ELG6
Position
complement(2698215..2700152)
Genome map
AA seq 645 aa AA seqDB search
MSSATTDSRDTTGYPPGTEFAALANADASLYSWAAEDRQGFWAEQARKLDWAQPWSQVLD
WSDAPVAKWFVGGKLNVAYNCVDRHVLAGYGDQVAIHWEGEPGDSRDITYGELRDEVCRA
ANYFTELGLRAGDRVAIYMPMVPEAIVSMLACARLGLTHSVVFAGFSPTALRQRVDDAEA
RLVVTTDGQWRRGTAAPLKAAVDEALGGAPSTVEHVLVVRRTGIEVPWTDGRDLWWHDTV
TDASPEHEAQAFDAEHPLFILYTSGTTGKPKGILHTSGGYLTQTAYTHHNVFDHKAGQDV
YWCTADIGWVTGHSYIVYGPLANRATQVVYEGTPNSPDEHRHFRIIEKYGVSIYYTAPTL
VRTFMKWGREIPDAHDLSSLRLLGSVGEPINPEAWRWYREVIGGDRTPIVDTWWQTETGS
IMISPLPGVTAAKPGAAMTPLPGISAKVVDDDSVELGRGAAGLLVLDQPWPSMLRGIWGD
MDRFRDTYWARFAAAGWYFAGDGAKLDADGDLWVLGRVDDVMNVSGHRISTAEVESALVG
HAGVAEAAVVGASDETTGQAIVAFVILAAGAANTGETLVTDLKAAVSHEISPIARPREIH
LVPELPKTRSGKIMRRLLRDVAEGRELGDTSTLVDPKVFEAIARG
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
ttgtccagcgccaccactgattcccgcgacaccaccggctacccgcccggcaccgagttc
gccgccctggcgaatgccgatgcatccctgtacagctgggccgccgaggatcggcagggg
ttctgggccgagcaggcgcgcaagctcgactgggcgcaaccgtggtcgcaggtgctggac
tggagtgacgcgccggtcgccaagtggttcgtcggcggcaagctgaacgtcgcctacaac
tgcgtcgaccggcacgtgctcgcggggtacggcgaccaggtcgccatccactgggagggc
gagcccggcgactcccgcgatatcacctacggggaactgcgcgacgaagtgtgcagggcc
gccaattatttcaccgagctgggtctgcgggcgggtgatcgggtcgccatctatatgccg
atggtgcccgaggccatcgtctcgatgctggcctgtgcccggctcggcctcacccactcg
gtggtgttcgcagggttctcccccaccgccctgcgccaacgagtcgacgacgccgaagcc
cggttggtcgtcaccaccgacgggcagtggcggcgtgggacggcggcgccgctgaaggcg
gccgtagacgaggcgctcggcggtgcgccgtccaccgtcgaacacgtattggtggtgcgg
cgcaccggaatcgaggtgccctggaccgacggccgcgacctgtggtggcacgacaccgtc
accgatgcctcgccggagcacgaggcgcaggccttcgacgccgagcacccgctgttcatc
ctctacacctccggcaccaccggaaaacccaagggcatcctgcacaccagcggcggctac
ctcacccagaccgcctacacccaccacaacgtcttcgatcacaaagccggacaagacgtc
tactggtgcaccgccgacatcggctgggtcaccggccacagctacatcgtctacggacca
ctggccaaccgcgccacccaagtggtctacgagggcacgccgaactcacccgacgagcac
cggcatttccggatcatcgaaaagtacggcgtcagcatctattacacggcaccgacactg
gtccgcaccttcatgaaatggggtcgcgagatccccgacgcgcacgacctgtcctcgctg
cggttgctcggcagcgtcggcgagccgatcaacccggaagcgtggcgctggtaccgcgag
gtcatcggcggcgatcgcacgccgatcgtggacacctggtggcagaccgagaccggctcg
atcatgatctcgccgctgcccggggtcaccgccgccaagcccggcgcggcgatgacaccg
ctgcccggcatctcggccaaggtggtcgacgacgacagcgtcgaactcggccgcggcgca
gccggattgcttgtgctcgaccagccgtggccgtcgatgctgcgcggcatctggggcgac
atggaccggttccgcgacacctactgggcccgattcgccgccgccggttggtatttcgcc
ggtgacggcgcgaagctcgacgccgacggcgatctctgggtgctcggccgggtggacgac
gtgatgaacgtgtccgggcaccggatctccaccgcggaagtggaatcggcgctggtcggt
catgccggggtcgccgaggccgcggtggtcggggccagtgacgagaccaccggacaggcc
atcgtcgccttcgtcattctcgccgcgggcgcggcgaacacgggcgagacccttgtcaca
gatctgaaagcggcggtctcgcacgagatcagcccgatcgcccggccccgcgagatccat
ctcgtgccggaactcccgaagacccgcagcggcaagatcatgcgccggctgctgcgtgac
gtggccgaaggccgcgaactcggcgacacctcgaccctggtcgaccccaaggtcttcgag
gccatcgcccgcgggtga

KEGG   Nocardia brasiliensis: O3I_031205Help
Entry
O3I_031205        CDS       T02270                                 

Definition
(GenBank) putative acyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00010  Glycolysis / Gluconeogenesis
nbr00620  Pyruvate metabolism
nbr00630  Glyoxylate and dicarboxylate metabolism
nbr00640  Propanoate metabolism
nbr00680  Methane metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_031205
   00620 Pyruvate metabolism
    O3I_031205
   00630 Glyoxylate and dicarboxylate metabolism
    O3I_031205
   00640 Propanoate metabolism
    O3I_031205
  09102 Energy metabolism
   00680 Methane metabolism
    O3I_031205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nbr01004]
    O3I_031205
Enzymes [BR:nbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     O3I_031205
Lipid biosynthesis proteins [BR:nbr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   O3I_031205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFU04190
UniProt: K0F4Q2
Position
complement(7069575..7071203)
Genome map
AA seq 542 aa AA seqDB search
MGIDLNPRVRELLDMYDRPAASAADVLCDRHPANGIAFTIVESDLSSTDLTYGELRERSS
RFAAALADLGIGPGDRVATLMAKSADLVVALLAIWRRGAVHVPLFTAFAPPAIAFRLEAS
RTTVVIADADQAGKLAPGPDMPADAPWQVIVSGAAPSGSLSMSELLAGKSADDPNAAAVA
VGGDGLLIQLFTSGTTGTPKGVPIPLRALASFQAYQEFALDVRTDDVYWNAADPGWAYGL
YWAILSPLSSGIRSLLLHAGFSAPLTWQVLEHFGVTNFTAAPTVYRALRAAGGTPPRIRL
RRASSAGEPLTPEVVAWSLEHLGVAVRDHYGQTEHGMLICNAWHEALDAEVPAGSMGRTL
PGWTCAVLADDADTVAPVGELGRVAIDTANSPLLWFLGYLDAPERTAQRFTPDGRWYITG
DAGSQDENGCFRFSARDDDVIIMAGYRIGPFEVESVLVLHDQVAEAAVVGMPDELRGEVL
EAFVVLRNGSGGSDELAAELQELVKRKFAAHAYPRTVHFVPELPKTPSGKVQRFVLRQKG
NK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgacttgaatccacgtgtgcgggagttgctggacatgtacgaccggccggcg
gcctcggccgccgacgtactgtgcgaccggcatcccgcgaacgggatcgcgttcaccatc
gtcgagagcgacctgtcgtcgaccgatctcacctatggcgaactgcgggagcgctcgtcc
cggttcgccgcggcgctggccgacctcgggatcgggcccggcgatcgggtcgctacattg
atggcgaagtccgctgacctggtggtcgcgctgctggccatctggcgccgcggggcggtg
cacgtcccgctgttcaccgcgttcgcgccgcccgccatcgcgttccggctcgaggcgagc
cggaccacggtcgtcatcgccgacgcagaccaggcgggcaagctggcgccggggccggac
atgcccgcggacgcgccgtggcaggtcatcgtcagcggcgcggcgcccagcggctcgttg
agcatgtcggagctgctggccggcaaatccgcggacgatccgaacgccgccgcggtcgcg
gtcggcggagacggactgctgatccagctcttcaccagcggcaccaccggcacaccgaag
ggggtgccgattccgttgcgcgccttggcttccttccaggcgtaccaagagttcgcgctc
gacgtccgcacggacgacgtgtactggaacgccgccgatccgggctgggcctacggcctc
tactgggcgattctgtcgccgctgtccagcggtatccgcagcctgctgctgcacgcgggc
ttctccgcgccgctcacctggcaggtgctcgaacacttcggcgtcacgaatttcaccgcc
gccccgaccgtgtaccgcgcgctgcgcgcggcgggcggcacgccgccgcggatcaggttg
cgccgtgcgtcgtcggcgggtgagccgctcacgccggaggtcgtggcctggtcgctggag
cacctcggcgtcgcggtgcgcgatcactacggtcagaccgagcacgggatgctcatctgc
aacgcctggcacgaggcgctcgacgcggaggtgcccgcggggtcgatgggacgcacactg
ccgggctggacctgtgcggtgctggccgacgacgcggacactgtcgcgcccgtcggcgaa
ctgggccgtgtcgcgatcgacacggccaacagtccgctgctgtggttcctcggctatctg
gacgcgcccgaacgcaccgcgcagcgcttcacgccggacggccgctggtacatcaccggt
gacgcgggctcgcaggacgagaacggctgcttccgcttctccgcccgggacgacgacgtg
atcatcatggccgggtaccggatcggccccttcgaggtggaaagcgtgctggtgctgcac
gatcaggtcgccgaggccgccgtggtcggcatgcccgacgaactgcgcggcgaagtactg
gaggcgttcgtggtgttgcgcaacggttccgggggcagcgacgaactcgcggcggagttg
caggagctggtgaagcggaagttcgccgcgcacgcctatccgcgcaccgtgcatttcgtg
ccggagctgccgaagacgcccagcggcaaggtgcagcgattcgtcctgcggcagaaggga
aacaagtga

DBGET integrated database retrieval system