KEGG   Nocardia brasiliensis: O3I_002770Help
Entry
O3I_002770        CDS       T02270                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00071  Fatty acid degradation
nbr00280  Valine, leucine and isoleucine degradation
nbr00281  Geraniol degradation
nbr00310  Lysine degradation
nbr00360  Phenylalanine metabolism
nbr00362  Benzoate degradation
nbr00380  Tryptophan metabolism
nbr00410  beta-Alanine metabolism
nbr00627  Aminobenzoate degradation
nbr00640  Propanoate metabolism
nbr00650  Butanoate metabolism
nbr00903  Limonene and pinene degradation
nbr00930  Caprolactam degradation
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01212  Fatty acid metabolism
Module
nbr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    O3I_002770
   00650 Butanoate metabolism
    O3I_002770
  Lipid metabolism
   00071 Fatty acid degradation
    O3I_002770
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O3I_002770
   00310 Lysine degradation
    O3I_002770
   00360 Phenylalanine metabolism
    O3I_002770
   00380 Tryptophan metabolism
    O3I_002770
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    O3I_002770
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    O3I_002770
   00281 Geraniol degradation
    O3I_002770
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O3I_002770
   00627 Aminobenzoate degradation
    O3I_002770
   00930 Caprolactam degradation
    O3I_002770
Enzymes [BR:nbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     O3I_002770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFT98516
UniProt: K0EM58
Position
complement(617739..618617)
Genome map
AA seq 292 aa AA seqDB search
MSEPAVPDEGEVVTYEVRGRVAIVTLNRPDYRNAQNSVMTYALDAAFERAVEDPEVGVIV
LAGNGKHFSAGHDIGTPGRDHHVRYPNKATLWWDHVDKTGGDQRFARELEVYLGMCRRWR
EIPKPTIAMVQGACIAGGLMLAWVCDLIIASDDAFFSDPVVRMGIPGVEYFAHPWVMGPR
AAKEFLFTGDRFGAAQAKEWGMVNRVVPRAELETETLALAEKIATMPRFGLALTKKAVNQ
AEDLMGMRAGMDSVFGLHHFAHAHNAEVGADSLGGMNAKSMKATATGENGAK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaccggctgtcccggacgaaggggaagtcgtcacctacgaggtgcgcggccgc
gtcgcgatcgtgacgctgaaccggccggactaccgcaacgcgcagaactcggtgatgacc
tacgcgctcgacgccgcgttcgaacgagccgtcgaggaccccgaggtcggggtgatcgtg
ttggcgggcaacggaaaacacttcagcgccggccacgatatcggcacgccgggccgcgac
caccacgtgcgctatccgaacaaggcgacgctgtggtgggatcacgtcgacaagaccggc
ggcgatcagcgtttcgcgcgcgagctcgaggtctacctcggcatgtgccggcgctggcgg
gagattcccaagccgaccatcgccatggtgcagggcgcgtgcatcgcgggcgggctgatg
ctcgcctgggtgtgcgatctgatcatcgcgtccgacgacgcgttcttctccgatcccgtt
gtacggatgggaattccgggcgtggagtacttcgcccatccgtgggtgatgggaccgcgc
gcggcgaaggagttcctgttcaccggcgaccgattcggcgcggcccaggccaaggagtgg
ggcatggtgaaccgggtcgtgccccgcgcggaactggagaccgagacgctggcgctggcc
gagaagatcgccaccatgccgcgcttcggtctcgcgctgaccaagaaggcggtcaaccag
gccgaagacctgatgggcatgcgggccgggatggactcggtgttcggcctgcaccacttc
gcgcacgcacacaacgccgaagtcggcgcggattcgctcggcggcatgaacgccaagtcg
atgaaggccaccgcgaccggcgagaacggggcgaagtag

DBGET integrated database retrieval system