KEGG   Nocardia brasiliensis: O3I_002800Help
Entry
O3I_002800        CDS       T02270                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00071  Fatty acid degradation
nbr00072  Synthesis and degradation of ketone bodies
nbr00280  Valine, leucine and isoleucine degradation
nbr00310  Lysine degradation
nbr00362  Benzoate degradation
nbr00380  Tryptophan metabolism
nbr00620  Pyruvate metabolism
nbr00630  Glyoxylate and dicarboxylate metabolism
nbr00640  Propanoate metabolism
nbr00650  Butanoate metabolism
nbr00900  Terpenoid backbone biosynthesis
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
nbr01212  Fatty acid metabolism
nbr02020  Two-component system
Module
nbr_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    O3I_002800
   00630 Glyoxylate and dicarboxylate metabolism
    O3I_002800
   00640 Propanoate metabolism
    O3I_002800
   00650 Butanoate metabolism
    O3I_002800
  09103 Lipid metabolism
   00071 Fatty acid degradation
    O3I_002800
   00072 Synthesis and degradation of ketone bodies
    O3I_002800
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O3I_002800
   00310 Lysine degradation
    O3I_002800
   00380 Tryptophan metabolism
    O3I_002800
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    O3I_002800
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O3I_002800
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3I_002800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nbr04147]
    O3I_002800
Enzymes [BR:nbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     O3I_002800
Exosome [BR:nbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   O3I_002800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C PIR
Motif
Other DBs
NCBI-ProteinID: AFT98522
UniProt: K0EGX3
Position
623972..625165
Genome map
AA seq 397 aa AA seqDB search
MSAPSAPRRPYTPLRDAYVIDAVRTPVGKRGGALAAVHPADLGAAALRGLLDRHSIDPGN
VDDVIVGCVDNVGPQAGNVGRTAWLAAGYPEEVPGVTVDRQCGSSQQAINFGAQAIMSGT
AEVIVAGGLQNMSAIPISAAMYAGKEYGFESPFVGAAGWDHRYGTAEVTQFRAAQLIAEK
WGISREDMERWALRSHERARDAIKNGRFDREIVPVGDFWIDQGPRETTLEKMASLPPLAE
GSPLTAAVASQISDGASATLLASDWAVETYGLTPRARIHHVSARGADPIFMLTAPIPATK
WALEKTGLTIEDIDVIEINEAFAPVVLAWLKETGADPEKVNVNGGAIALGHPLGATGAKL
FATLLNELERRNGRYGLLTICEGGGTANVTIIERLPH
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaccctccgctccccgccgcccctacaccccgctgcgggacgcctacgtgatc
gatgcggtgcgcacaccggtcggtaagcgcggcggcgccctcgccgccgtgcacccggcc
gacctcggcgccgccgcgctgcgcgggctgctggatcgccactcgatcgacccgggcaat
gtcgacgacgtgatcgtcggctgtgtcgacaacgtcggcccgcaggccggcaacgtcggc
cggaccgcctggctggccgccggatacccggaagaggtacccggcgtcaccgtcgaccgg
cagtgcggatccagccagcaggccatcaatttcggtgcgcaggcgatcatgagcggcacc
gccgaggtgatcgtcgcgggcggcctgcagaacatgagcgccatcccgatctccgccgcc
atgtacgcgggcaaggagtacggcttcgagtcgccgttcgtcggcgccgccggctgggac
caccgctacggcaccgccgaggtcacgcagttccgtgccgcccagttgatcgccgagaag
tggggcatcagccgagaagacatggagcgctgggctttgcgcagccacgagcgggcccgc
gacgcgatcaagaacggccgtttcgatcgcgagatcgtgccggtcggcgatttctggatc
gatcaggggccgcgcgagaccaccctggagaagatggcgtcgctgccgccgctggccgag
ggcagcccgttgaccgcggccgtcgcgagccagatctccgacggcgccagcgccaccctg
ctcgcctccgactgggccgtcgagacttacggtttgaccccgcgcgcccgcatccatcac
gtcagcgcccgcggcgccgaccccatcttcatgctcaccgcgccgatcccggccaccaag
tgggcgctcgaaaagaccggtctcactatcgaggacatcgacgtcatcgagatcaacgag
gccttcgcccccgtcgtcctggcctggctgaaggaaaccggtgccgaccccgaaaaggtc
aacgtcaacggcggcgccatcgccctggggcaccccctcggcgccaccggcgcaaagctt
ttcgccaccctcctcaacgaactggaacgccgcaacggccgctacggcctcctcaccatc
tgcgaaggcggcggcaccgccaacgtaaccatcatcgagcgcctcccccactga

DBGET integrated database retrieval system