KEGG   Nocardia brasiliensis: O3I_005380Help
Entry
O3I_005380        CDS       T02270                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00020  Citrate cycle (TCA cycle)
nbr00190  Oxidative phosphorylation
nbr00650  Butanoate metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Module
nbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nbr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3I_005380 (sdhB)
   00650 Butanoate metabolism
    O3I_005380 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    O3I_005380 (sdhB)
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     O3I_005380 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     O3I_005380 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_18 Fer4_7 Fer4_16 Fer4_4 Fer4 Fer4_2
Motif
Other DBs
NCBI-ProteinID: AFT99038
UniProt: K0EPU3
Position
complement(1254599..1255312)
Genome map
AA seq 237 aa AA seqDB search
MMVTVKVARFNPEDDKGAHWESFQVPVLPTDRFLNVLIYIKSYLDGTLTFRRSCAHGVCG
SDAMRINGVNRLACKVLMKDMLPKGDKTLTITVEPIRGLPVEKDLVVNMEPFFDAFRAVK
PYLMTSGNEPTRERIQSQADRARFDDTTKCILCACCTTSCPVYWSDGSYFGPAAIVNAHR
FIFDSRDEGARERLDILNDVEGVWRCRTTFNCTDACPRGIEVTKAIQEVKRALLFAR
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gtgatggtcaccgtcaaggtggcccggttcaacccggaggacgacaagggtgcgcactgg
gagtcgttccaggtgccggtgctgccgacggaccgattcctcaacgtgctcatctacatc
aagtcctacctggacggcacgctgacgttccggcggtcctgcgcgcacggtgtgtgcggc
tccgacgccatgcggatcaacggggtgaaccggttggcctgcaaggtgctgatgaaggac
atgctgcccaagggcgacaagaccctcaccatcaccgtcgagccgatccgcggcctgccc
gtggagaaggacctcgtggtgaacatggagccgttcttcgacgcgttccgcgcggtgaag
ccgtacctgatgacctcgggcaacgagccgacccgcgagcgcatccagtcgcaggccgac
cgcgcgcgcttcgatgacaccaccaagtgcatcctctgtgcgtgctgcaccacctcgtgc
cccgtgtactggagcgacggcagctacttcggtcccgccgccatcgtcaacgcgcaccgc
ttcatcttcgacagccgcgacgagggtgcccgcgagcgcctcgacatcctcaacgatgtc
gaaggcgtctggcgctgccgcaccaccttcaactgcaccgacgcgtgcccccgcggcatc
gaggtcaccaaggccatccaagaagtcaagcgggcactcctcttcgctcgctga

KEGG   Nocardia brasiliensis: O3I_005385Help
Entry
O3I_005385        CDS       T02270                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00020  Citrate cycle (TCA cycle)
nbr00190  Oxidative phosphorylation
nbr00650  Butanoate metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Module
nbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nbr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3I_005385 (sdhA)
   00650 Butanoate metabolism
    O3I_005385 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    O3I_005385 (sdhA)
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     O3I_005385 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     O3I_005385 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 HI0933_like DAO Pyr_redox_2 FAD_oxidored GIDA
Motif
Other DBs
NCBI-ProteinID: AFT99039
UniProt: K0EQD0
Position
complement(1255372..1257138)
Genome map
AA seq 588 aa AA seqDB search
MSESRIQEHRYDVVIVGAGGAGMRAAIEAGPRARTAVLTKLYPTRSHTGAAQGGMCAALA
NVEEDNWEWHTFDTVKGGDYLVDQDAAEIMAKEAIDAVMDLEKMGLPFNRTPEGKIDQRR
FGGHTRDHGKAPVRRACYAADRTGHMILQTLYQNCVKHDVEFYNEFYVLDLVLSDTDRGQ
VATGVVAYELATGDIHVFHAKSIIFATGGSGRMYKTTSNAHTLTGDGMAIVFRKGLPLED
MEFHQFHPTGLAGLGILISEAVRGEGGILRNASGERFMERYAPTIKDLAPRDIVARSMVL
EVLEGRGAGPNKDYVYIDVTHLGEDVLEEKLPDITEFARTYLGVDPVTELVPVMPTCHYV
MGGIPTKIRGEVLRNNTDVLPGLYAAGECACVSVHGSNRLGTNSLLDINVFGRRAGIAAA
EYAHRTEFVDLPDKPAQMVQDWLALILSEHGDERVADIRTELQYTMDMNAAVFRTEDTLK
QALTDIHVLKERYSRITVQDKGKRYNSDLLEAVELGFLLELAEVTVVGALNRKESRGGHA
REDYPDRDDVNFMRHTMAYKESADLISDIRLDFKPVVQTRYEPMERKY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatcgcggattcaggagcatcgctacgacgtcgtgatcgtcggtgccggtggc
gccggcatgcgcgcggcgatcgaggccgggccccgggcgcgtaccgccgtcctgaccaag
ttgtacccgacccgcagccacaccggcgcggcacagggtggcatgtgcgccgcactggcg
aacgtcgaagaagacaactgggaatggcacaccttcgacaccgtcaagggtggcgactac
ctggtcgaccaggatgccgcggagatcatggccaaagaggccatcgacgcggtgatggac
ctggagaagatgggtctgccgttcaaccggacgcccgagggcaagatcgaccagcgtcgt
ttcggtggtcacacccgcgatcacggcaaggccccggtgcgacgcgcgtgctacgcggcc
gaccgcaccgggcacatgatcctgcagacgctgtaccagaactgcgtcaagcacgacgtc
gagttctacaacgagttctacgtgctcgacctggtactcagcgataccgaccggggccag
gtcgccaccggcgtcgtcgcctacgagctggccaccggtgacatccacgtcttccacgcg
aagtcgatcatcttcgccaccggcggttccggccggatgtacaagaccacctcgaacgcg
cacacgctgaccggtgacggcatggcgatcgtgttccgcaagggtcttccgttggaggac
atggaattccaccagttccatccgacgggcctggccggtctcggcatcctgatctccgaa
gccgtgcgcggcgagggcggcatcctgcgcaacgccagcggtgagcgcttcatggagcgc
tacgcccccaccatcaaggacctcgcgccgcgcgatatcgtcgcccgctcgatggtgctc
gaggtgctcgagggtcgcggcgccgggccgaacaaggactacgtctacatcgacgtgacc
cacctcggcgaggacgtgctcgaggagaagctgcccgacatcaccgaattcgcgcgcacc
tacctgggtgtcgacccggtgaccgagctggtgccggtcatgccgacctgtcactacgtg
atgggtggtatcccgaccaagatccgcggcgaggtgctgcgcaacaacaccgacgtgctg
cccggcctgtacgccgcgggcgaatgcgcctgcgtgtcggtgcacggctccaaccgcctc
ggcaccaactcgctgctcgacatcaacgtgttcggccgccgcgccggcatcgccgccgcc
gagtacgcgcaccgcaccgagttcgtcgacctgccggacaagcccgcgcagatggtgcag
gactggctcgcgctgatcctgtccgagcacggcgacgagcgggtcgccgatatccgtacc
gagttgcagtacacgatggacatgaacgccgccgtgttccgcaccgaggacaccctcaag
caggccctcaccgatatccacgtgctgaaggagcgctacagccggatcacggtgcaggac
aagggcaagcgctacaacagcgacctgctggaggccgtcgagctcggcttcctgctggag
ctggccgaagtcaccgtcgtcggtgcgctcaaccggaaggaatcgcgcggcggccacgcg
cgcgaggactacccggaccgcgacgacgtgaacttcatgcggcacacgatggcctacaag
gaaagcgcggatctgatctccgacatccgcctcgacttcaagccggtggtgcagacccgt
tacgagccgatggagcgtaagtactga

KEGG   Nocardia brasiliensis: O3I_005390Help
Entry
O3I_005390        CDS       T02270                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00020  Citrate cycle (TCA cycle)
nbr00190  Oxidative phosphorylation
nbr00650  Butanoate metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Module
nbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nbr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3I_005390
   00650 Butanoate metabolism
    O3I_005390
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    O3I_005390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Ninjurin
Motif
Other DBs
NCBI-ProteinID: AFT99040
UniProt: K0ETN9
Position
complement(1257154..1257585)
Genome map
AA seq 143 aa AA seqDB search
MSAPVLGKSYDRPASLDSPRSPRARSKNNFEMYAWVFMRFSGLLLIVLVLGHMTIMLLLD
GGVKRLNFGFVAGRWASPFWQIWDLTMLWLAQLHGGNGLRTVIADYSRKDSTRFWLNTLL
AISMILILAVGTYVIFTFDPNIS
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcacctgttctgggtaagtcctacgaccggccggccagcctggattcgccgcgc
tcgccccgcgcccgctcgaagaacaacttcgagatgtacgcctgggtgttcatgcgcttc
tccggcctgctgctgatcgtgctcgtgctcggccacatgacgatcatgctgctactcgac
ggcggcgtgaagcggctcaacttcggcttcgtcgccggccgctgggccagcccgttctgg
cagatctgggacctgaccatgctctggctcgcccagctgcacggcggcaacggcctgcgc
acggtgatcgcggactactcccgcaaggactcgactcggttctggctgaacaccctgctg
gccatctcgatgattctgatcctggccgtcggcacgtacgtcatcttcaccttcgacccc
aacatcagttag

KEGG   Nocardia brasiliensis: O3I_005395Help
Entry
O3I_005395        CDS       T02270                                 

Definition
(GenBank) succinate dehydrogenase cytochrome b subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00020  Citrate cycle (TCA cycle)
nbr00190  Oxidative phosphorylation
nbr00650  Butanoate metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Module
nbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nbr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3I_005395
   00650 Butanoate metabolism
    O3I_005395
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    O3I_005395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_D
Motif
Other DBs
NCBI-ProteinID: AFT99041
UniProt: K0ENQ2
Position
complement(1257587..1257922)
Genome map
AA seq 111 aa AA seqDB search
MWSWALHRITGCTIFFFLFVHVLDTALVRVSPDTYNQAIETYKTPIVALMEMGLVVVVLF
HALNGVRVILVDFWAKGPKYQRTMLWIILAIWFLLAVPAIGRQFFYLFTEH
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcctgggcgctgcaccggatcaccggttgcaccatcttcttcttcctcttcgtg
cacgtcttggataccgcgctggtccgagtcagtccggacacctacaaccaggcgatcgag
acctacaagacgcccatcgtcgccctgatggaaatgggcttggtcgtcgtcgtgctcttc
cacgcgctcaacggcgtccgcgtgatcctggtcgacttctgggccaagggccccaagtac
cagcgcacgatgctctggatcatcctcgcgatctggttcctgctggcggtgcccgccatc
ggccgccagttcttctacctcttcacggagcattga

KEGG   Nocardia brasiliensis: O3I_041735Help
Entry
O3I_041735        CDS       T02270                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00020  Citrate cycle (TCA cycle)
nbr00190  Oxidative phosphorylation
nbr00650  Butanoate metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Module
nbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nbr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3I_041735 (sdhA)
   00650 Butanoate metabolism
    O3I_041735 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    O3I_041735 (sdhA)
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     O3I_041735 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     O3I_041735 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like GIDA Thi4 AlaDh_PNT_C Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AFU06292
UniProt: K0F9A4
Position
9343773..9345704
Genome map
AA seq 643 aa AA seqDB search
MERHKYDVVVIGAGGAGLRAVIEAREHGHSVAVVCKSLFGKAHTVMAEGGCAASMGNANE
KDNWQTHFKDTMRGGKFLNNWRMAELHAQEAPDRVWELETYGALFDRTADGRISQRNFGG
HTYPRLAHVGDRTGLEIIRTMQQKIVSLQQEDFAATGDYESRIKVFSECTITELLKDGDR
ISGAFGYWRESGRFILFETPAVVLATGGIGKSYKVTSNSWEYTGDGHALALRAGATLINM
EFLQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNTEGKRFMFDYIPPVFKGQYAETEEEA
DQWLRDNDSARRTPDLLPRDEVARAINEEVKAGRGTPHGGVFLDIASRMPAEEIVRRLPS
MHHQFKELADVDITKEPMEVGPTCHYVMGGVEVDPDTGAATVPGLFAAGECSGGMHGSNR
LGGNSLSDLLVFGRRAGLGAAAYVERLTERPAVSDADISAAAKVALAPFDPPAEGAGENP
YTLHTDLQQTMNDLVGIIRKEHEVREALAKLDELRARFQQVTVEGHRQFNPGWHLALDLE
NMLLVSECVAKAALLRTESRGGHTRDDHPSMDADWRNKLLVCAVDQSTTGQAIPDVTVTP
KDQVPMRPELLALFDLGELEKYYTPAELAGHPATAGNSTEREA
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
gtggaacggcacaagtacgacgtcgtcgtgatcggagccggtggcgccggattgcgcgcg
gtgatcgaggccagggaacacggccattccgtcgcggtggtgtgcaaatccttgttcggc
aaggcgcacaccgtgatggccgaaggcggctgcgccgcgtcgatgggtaatgccaacgag
aaggacaactggcagacccatttcaaggacacgatgcgcggcggcaagttcctgaacaac
tggcgcatggccgaactgcatgcccaggaggcgcccgaccgggtgtgggagctggaaacc
tatggggcactgttcgatcggaccgccgacggccggatcagccagcgcaacttcggtggc
cacacctacccgcggctcgcacacgtgggcgaccggaccggcctggagatcatccgcacc
atgcagcagaagatcgtctcgctgcagcaggaggacttcgcggcgaccggcgactacgag
tcgcggatcaaggtcttctccgagtgcacgatcaccgaactgctcaaggacggcgaccgc
atctcgggcgcgttcggctactggcgcgaatccggccgtttcatcctgttcgaaacgccc
gcagtggttttggcgaccggcggcatcggcaagtcgtacaaggtgacctcgaactcgtgg
gagtacaccggtgacggtcacgcgctcgcgctgcgcgccggcgcgacgctgatcaacatg
gagttcctgcagttccacccgaccgggatggtctggccgccgagcgtcaagggcatcctg
gtcaccgagggtgtgcgcggcgacggcggggtgctcaagaacaccgaaggcaagcggttc
atgttcgactacatcccgccggtcttcaaggggcagtacgccgagaccgaggaagaagcc
gatcagtggttgcgcgacaacgattccgcgcgccgcacgcccgacctgctgccccgcgac
gaggtcgcgcgggcgatcaacgaggaggtcaaggcaggccgcggtaccccgcacggcgga
gtgttcctcgatatcgcctcgcggatgcccgccgaggagatcgtgcggcgactgccctcc
atgcaccaccagttcaaagagctcgccgacgtggacatcacgaaggagccgatggaggtc
ggcccgacctgtcactacgtgatgggcggcgtcgaggtcgatcccgataccggcgcggcg
accgtgcccggattgttcgcggccggtgagtgttccggcggcatgcacggctccaaccgg
ctgggcggcaactcgctctcggatctgctggtgttcggccgccgggccggcctgggcgcg
gccgcgtacgtcgaacggctcaccgaacgtcccgcggtctcggatgccgatatcagcgcg
gccgcgaaagtggcgctggcaccgttcgatccgccggccgagggcgcgggcgagaacccg
tacaccctgcacaccgatctgcagcagacgatgaacgacctggtcgggatcatccgcaag
gaacacgaggtgcgcgaggcgctcgccaagctcgacgagctgcgtgcccggttccagcag
gtcaccgtcgagggtcaccgccagttcaacccgggctggcacctcgcgctcgacctggag
aacatgctgctggtcagcgagtgcgtggcgaaggcggcgctgctgcgcaccgagagccgc
ggcgggcacacccgcgacgatcacccgtcgatggatgccgactggcgcaacaagctgttg
gtatgcgcggtggatcagagcacgacgggccaggccatccccgacgtcacagtgacgccc
aaggaccaggttccgatgcggccggagctgctcgcccttttcgacctcggcgagctcgaa
aagtactacaccccggccgaactcgccgggcacccggcgacagccgggaattcgacagag
cgagaggcgtag

KEGG   Nocardia brasiliensis: O3I_041740Help
Entry
O3I_041740        CDS       T02270                                 

Definition
(GenBank) fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00020  Citrate cycle (TCA cycle)
nbr00190  Oxidative phosphorylation
nbr00650  Butanoate metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Module
nbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nbr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3I_041740
   00650 Butanoate metabolism
    O3I_041740
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    O3I_041740
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     O3I_041740
    1.3.5.4  fumarate reductase (quinol)
     O3I_041740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_18 DUF1126
Motif
Other DBs
NCBI-ProteinID: AFU06293
UniProt: K0F2C0
Position
9345707..9346453
Genome map
AA seq 248 aa AA seqDB search
MGYDAKFRVWRGDLEGGELHDFTVAVNEGEVVLDIIHRLQATQAPDLAVRWNCKAGKCGS
CSAEVNGRPRLLCMTRMSTFTEAEVITVTPMRTFPVIKDLVTDVSFNYQKAREIPSFTPP
ADLKPGDYRMKQVDVERSQEFRKCIECFLCQNTCHVVRDHEENKTSFAGPRFLMRIAELE
MHPLDVGDRRDLAQDEQGLGLCNITKCCTEVCPEHIKITDNALIPMKERVADRKYDPLVW
LGNKLFRR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggttacgacgccaaattccgcgtatggcgcggcgatctcgagggcggcgaactgcac
gacttcaccgtggcggtgaacgagggcgaggtggtgctcgacatcatccaccggctgcag
gcgacgcaggcccccgatctggccgtgcgctggaactgcaaggcgggcaagtgcggatcg
tgctcggccgaggtgaacgggcggccgcggctgctgtgcatgacccggatgtccaccttc
accgaggccgaggtcatcacggtgaccccgatgcgcaccttcccggtgatcaaggatctg
gtcaccgacgtctcgttcaattaccagaaggcgcgcgagattccgtcgttcaccccgccc
gcggatctgaagccgggcgactaccggatgaagcaggtggacgtcgagcgctcgcaggag
ttccgcaagtgcatcgaatgcttcctgtgccagaacacctgccacgtggtgcgtgaccac
gaggagaacaagacgtcgttcgccgggccgcggttcctgatgcggatcgccgagctggag
atgcacccgctcgacgtcggcgaccggcgcgatttggcgcaggacgaacagggtctcggc
ctctgcaatatcaccaaatgctgtaccgaggtctgcccggaacatatcaagatcaccgac
aacgcgttgatcccgatgaaagagcgcgtggccgatcggaaatacgatccgctggtgtgg
ttgggcaacaagctgttccgccgctga

DBGET integrated database retrieval system