KEGG   Nocardia brasiliensis: O3I_014240Help
Entry
O3I_014240        CDS       T02270                                 

Definition
(GenBank) terpene synthase metal-binding domain-containing protein
  KO
K10187  germacradienol/geosmin synthase [EC:4.2.3.22 4.2.3.75 4.1.99.16]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00909  Sesquiterpenoid and triterpenoid biosynthesis
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    O3I_014240
Enzymes [BR:nbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.16  geosmin synthase
     O3I_014240
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.22  germacradienol synthase
     O3I_014240
    4.2.3.75  (-)-germacrene D synthase
     O3I_014240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C TRI5 Malate_DH
Motif
Other DBs
NCBI-ProteinID: AFU00809
UniProt: K0EUQ4
Position
complement(3180360..3182627)
Genome map
AA seq 755 aa AA seqDB search
MQPFELPDFYMPYPARLNPHVDSARAHTRVWAESMGFFEDAAGHHIWSESDLERHDYGLL
CAYTHPDCDSRELDLITDWYVWVFYFDDHFLELFKRTRDTKGAKEYLDRLRDFMPLAGGP
LPEPTNPVERGLADLWVRTVPAMSMDWRTRFAATTTALLEESRWELANIAEGRIANPIEY
IEMRRKVGGAPWSANLVEHAVGAQIPAELATTRPLEVLRDTFADAVHLRNDIFSYEREVR
QEGENANGILVVEQFFGYETQQSAEVVNNLLTSRLQQFEHTAVTELPVLFAERAVGPEDQ
AAVLAYSKGLQDWQSGGHEWHMRSSRYMNKGPAADGDPLRRLFKPAGLGSAAVYLFSPTV
VLEPGRLRSFLHPRQELAEPIEFPEIPMPYQLQLSPHLAGARASLLAWGARIGFHDPLPE
FGGRPLWRPEDLAEFDFALCSAGIDPDATLAEVEMSASWLAWGTFVDDYYPQVFAQRKDL
AGAKAQSARLRACMPADEAAPTPASNAMERGLAALWARTTANLPDDQRAELRRAVEVFLD
ASEWEVVNDITNRMPDPVDYVEMRRRTFGADLTIALARISRAELIAPEVYRTQTLADLEH
TATDVCTLLNDLYSYHKETRYEGDFHNAVRVLRNFLDCETEAAVTAVHELLTARLHQFER
IVDSELPALYEEYDLAPEVRAAIDRRAVELQDWMAGILNWHAASLRYQEQHLEQRYGAAA
LTEAAEEARPDPGYLRPSGLGTSAARFDRALQVTP
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcccttcgaactccccgatttctacatgccgtatccggcccggctcaacccgcac
gtcgactccgcccgcgcgcacacccgagtgtgggccgagtcgatgggcttcttcgaagat
gcggcgggacaccatatctggagcgagtccgatctcgaacggcacgactacggtctgctg
tgcgcgtacacccaccccgactgcgacagccgggaactggatctcatcaccgactggtac
gtgtgggtgttctatttcgacgaccacttcctcgaattgttcaaacgtacccgagacacc
aagggcgccaaggaatacctggatcggctgcgggatttcatgccgctggccggcggcccc
ctgccggagccgaccaacccggtcgagcgcggcctggccgacctgtgggtgcgcacagta
cccgcgatgtcgatggattggcggactcggttcgccgcgaccaccaccgcgctgctggag
gaatcgcggtgggaactggccaacatcgccgagggccggatcgcgaacccgatcgaatac
atcgagatgcgccgcaaagtcggcggcgcgccgtggtcggcgaacctggtcgagcacgcc
gtcggcgcacagatcccggccgagctggccaccacccggccgctggaagtgttgcgagac
accttcgccgacgccgtgcatctgcgcaacgacatcttctcctatgagcgggaggtacgg
caggaaggcgagaacgccaacggaatcctggtggtggaacagttcttcggctacgagacc
cagcagagcgccgaggtcgtgaacaacctgctgacctcccgcctgcaacagttcgagcac
accgcggtcaccgagctgcccgtgctgttcgccgagcgggccgtcggcccggaggatcag
gccgccgtgctggcgtactcgaaaggcttgcaggactggcaatccggcggccacgaatgg
cacatgcggtcgagccggtacatgaacaagggcccggccgcggacggtgatccgctgcgc
aggctgttcaaacccgccggcctcggcagtgccgcggtgtatctgttctcccccaccgtg
gtgctggagccgggccgcctgcgcagcttcctgcacccgcggcaggaattggccgaaccg
atcgagtttcccgagatcccgatgccgtatcagctccagctgagtccgcatctggcgggc
gcacgcgcgagtctgctcgcctggggcgcgcggatcggcttccacgacccgctgcccgag
ttcggcgggcgcccgctctggcgcccggaagatttggcggagttcgacttcgcactgtgc
tcagcgggcatcgaccccgatgcgaccctcgcggaagtggagatgtcggcctcgtggctg
gcctggggcaccttcgtggacgactactacccacaggttttcgcgcagcgcaaagacctc
gccggagcaaaggcccaaagcgcccggctgcgtgcgtgcatgcccgccgacgaagccgcg
ccgacacccgcgagcaacgcgatggagcgcggactcgcggcgctgtgggcccgcaccacg
gcgaacctgcccgacgaccagagagctgaattgcgccgagcggtcgaggttttcctcgat
gcgtcggaatgggaagtagtcaacgacatcaccaaccggatgcccgatccggtcgattac
gtggagatgcgcaggcgcactttcggcgctgatctcacgatcgcgctggctcggatctcg
cgcgcggaactcatcgcgcccgaggtctatcgcacgcagaccctcgcggatctggagcac
accgcgaccgacgtctgcacgctgctgaacgatctgtactcgtatcacaaggaaacccgg
tacgagggcgacttccacaacgccgtacgggtgctgcggaacttcctcgactgcgagacg
gaggccgccgtcacagcggtgcacgagctcttgaccgcgcgactgcaccagttcgagcgg
atcgtcgacagcgaattgccggccctgtacgaggaatacgacctcgcccccgaggtgcgc
gccgccatcgaccggcgcgcggtggaactccaggactggatggccggaatcctgaactgg
catgccgcatcgctccgctatcaggagcagcacctcgaacagcgttacggggcagcggct
ctgaccgaggcagccgaggaggcccggcccgacccgggctatctacgaccgagcggcctc
ggcaccagtgccgcccgattcgatcgagcattgcaggtgacgccatga

DBGET integrated database retrieval system