KEGG   Nocardia brasiliensis: O3I_014255Help
Entry
O3I_014255        CDS       T02270                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase [NADP(+)] GabD
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00350  Tyrosine metabolism
nbr00650  Butanoate metabolism
nbr00760  Nicotinate and nicotinamide metabolism
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    O3I_014255
  09105 Amino acid metabolism
   00310 Lysine degradation
    O3I_014255
   00350 Tyrosine metabolism
    O3I_014255
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    O3I_014255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFU00812
UniProt: K0ETQ6
Position
complement(3185476..3185682)
Genome map
AA seq 68 aa AA seqDB search
MAAYLYTADVDRALRIAERLDADMAGVNRGVVSDVAAPFSGVEASGLGREAGTEGIEEYL
ETAYLALP
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
ttggccgcatacctttacaccgccgacgtggatcgtgcgctgcgcatcgccgagcgtctc
gacgccgacatggccggtgtcaatcgcggcgtcgtctccgatgtggccgcgccgttcagc
ggcgtcgaggcatccggcctcggccgggaagcgggtaccgaaggcatcgaggagtacctc
gaaaccgcctacctcgcgctgccgtaa

KEGG   Nocardia brasiliensis: O3I_020190Help
Entry
O3I_020190        CDS       T02270                                 

Gene name
gabD2
Definition
(GenBank) succinic semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00250  Alanine, aspartate and glutamate metabolism
nbr00310  Lysine degradation
nbr00350  Tyrosine metabolism
nbr00650  Butanoate metabolism
nbr00760  Nicotinate and nicotinamide metabolism
nbr01100  Metabolic pathways
nbr01120  Microbial metabolism in diverse environments
Module
nbr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    O3I_020190 (gabD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O3I_020190 (gabD2)
   00310 Lysine degradation
    O3I_020190 (gabD2)
   00350 Tyrosine metabolism
    O3I_020190 (gabD2)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    O3I_020190 (gabD2)
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     O3I_020190 (gabD2)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     O3I_020190 (gabD2)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     O3I_020190 (gabD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFU01997
UniProt: K0EWY6
Position
4521165..4522757
Genome map
AA seq 530 aa AA seqDB search
MTTETTHTPAAALPARITAALIERLTGSIAADGTAAPYPMTEVYTGAALGELPQSTPDDV
RVAGVSARAAQREWAALPLRDRLRVFERAHELILSEVETIADLIQIGCGKTRRMAVEESC
DVPMVISHYLKTARRVLRPKRRGGALPLLTTSTEEHRPKGLVAVIAPWNFPFAIALSDAM
PALIAGNGVILKPDNKTALCVLFGVELLHRAGLPRGLVQVVCGEGPDIGPSLIDAVDFVV
FTGSTATGRVVGERAGRNLIGCSLELGGKNPMLVLEDANLDEAIAGATFAVFANSGQACM
HIERIYVHRSRYDDFVRGLVAAAAALNTKIGAAYDYTPEFGSLVSPQHRDRVAAHVDEAR
AKGATVLVGGKARPDIGPAFYEATVLTGVTPEMAHATQETFGPVVSVYPFDDEREAVRLA
NATDYGLNASVWSRDLARANRIAAQLQAGNININDGFVATYAAKATPSGGLKQSGVGTRH
GDQGLLKYTDTVNVGVLKRQVLAARAGQPYEKQVKTTLMSLRLMRRTRLR
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgagaccacccacaccccggcggcggcgttgcccgcccggatcaccgccgcg
ttgatcgagcgcctcaccggctcgatcgccgccgacggcaccgccgcgccgtatccgatg
acggaggtctacaccggtgcggcgctgggcgagctgccgcagtccacgcccgacgacgtc
cgcgtcgccggggtgagtgcccgtgccgcgcaacgggaatgggccgcgctgccactgcgg
gatcggctgcgggtgttcgagcgggcgcacgaactgatcctgagcgaggtcgagaccatc
gccgatctgatccagatcggctgcggcaagacccgccggatggcggtcgaggaatcctgt
gacgtgccgatggtcatcagccactacctgaaaaccgcgcgccgggtgctgcggccgaag
cggcgcggtggcgccctgccactgctcacgacctcgaccgaggagcatcgccccaaaggt
ctggttgcggtcatcgcgccgtggaacttccccttcgccatcgcgctctccgacgcgatg
cccgcgctgatcgcgggcaacggcgtaatcctcaagccggacaacaagaccgcgctctgc
gtgctgttcggcgtggagctgctgcatcgggcgggcctgccgcgtgggctggtccaggtg
gtctgcggggaggggccggatatcgggccgagcctgatcgatgccgtggatttcgtggtg
ttcaccggttcgaccgcgaccggccgggtggtgggtgagcgtgccgggcgcaacctgatc
gggtgcagtctggaactgggcggcaagaatccgatgctggtgctcgaggacgcgaacctg
gacgaggcgatcgccggcgcgacgttcgcggtgttcgccaactccggccaggcctgcatg
cacatcgagcggatctacgtgcaccgcagccggtacgacgatttcgtgcgcggcctggtc
gccgccgccgcggcgttgaacacgaagatcggcgccgcctacgactacacacccgaattc
ggctcgctggtatcgccccagcatcgcgaccgggtggccgcgcacgtcgacgaggcccgc
gcgaagggcgcgaccgtcctggtcggcggcaaggcgcgcccggacatcggcccggcgttc
tacgaggcgactgtgctcaccggcgtcacgcccgagatggcgcatgcgacgcaggagaca
ttcggaccggtcgtcagcgtctatccgttcgacgacgaacgggaggccgtccggctcgcc
aatgccaccgactacggcttgaacgccagcgtgtggagccgggacctggcccgcgccaac
cggattgccgcgcaactgcaagcgggcaatatcaacatcaacgacggtttcgtggcgacc
tacgcggccaaggcgacgccgtcgggcgggctcaagcagtccggtgtcggcacccggcac
ggcgatcaagggctgctcaaatacaccgacacggtgaacgtcggtgtgctcaaacgtcag
gtgctcgccgctcgtgcggggcagccctacgagaagcaagtgaagacgacgctgatgtcg
ctgcggctgatgcgccgaaccaggctgcgctga

KEGG   Nocardia brasiliensis: O3I_022535Help
Entry
O3I_022535        CDS       T02270                                 

Definition
(GenBank) putative succinate-semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00250  Alanine, aspartate and glutamate metabolism
nbr00310  Lysine degradation
nbr00350  Tyrosine metabolism
nbr00650  Butanoate metabolism
nbr00760  Nicotinate and nicotinamide metabolism
nbr01100  Metabolic pathways
nbr01120  Microbial metabolism in diverse environments
Module
nbr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    O3I_022535
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O3I_022535
   00310 Lysine degradation
    O3I_022535
   00350 Tyrosine metabolism
    O3I_022535
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    O3I_022535
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     O3I_022535
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     O3I_022535
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     O3I_022535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFU02462
UniProt: K0EY66
Position
5125390..5126844
Genome map
AA seq 484 aa AA seqDB search
MRDRTALLDEVPTGLWLAGRQVAAGDAATFPVHDPATGAVLAEVADATVADGAAALDAAA
AAQRDWAARPSRERAEILHRAWELVLERRDDFALLMTSEMGKPLAESHGEVTYGAEFLRW
FAEEAVRVHGRYTHSPSGNGRILVTKQPVGPTLAITPWNFPLAMGTRKIAPALAAGCTMV
VKPAPETPLTMLLLGRMFAEAGLPPGVLSILPTARAAELTGPLLTDPRLRKVTFTGSTAV
GKLLLARSADRMLRTSMELGGNAPFVVFADADLDAAVDGAMAAKMRNTGEACTAANRFHV
DNAVRAEFTAKLTARMLALKLGPGHLDGVQVGPLINERQRNTVSDLVLDAVAKGAVVTTG
GHSLPGEGFFYAPTVLADVPADARILREEVFGPVAAITGFDGETAGVEAANDTEFGLAAY
IYTKDLDRALRVAEAVESGMVGVNRGIVSDVAAPFGGMKQSGLGREAGTEGIEEYLETKY
LALR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaccgaaccgctctactcgatgaggtgccgaccgggctgtggctcgcgggacgg
caggtggcggccggtgacgccgccacgttcccggtccatgatccggcgaccggggcggtg
ctcgccgaggtggccgacgccacggtcgccgacggtgccgccgcgctcgacgccgccgcg
gcggcgcagcgggactgggccgcgcggccgtcccgcgaacgcgccgagattctgcatcgg
gcctgggaactggtgctcgaacggcgcgacgacttcgccttgctgatgacctcggagatg
ggaaaaccgttggcggagagccacggtgaggtcacctacggcgccgagttcctgcgctgg
ttcgccgaggaagcggtgcgcgtacacggccgctacacccattcgccctcgggcaacggc
cggatcctggtgaccaaacagcccgtcggccccacgctggcaatcacgccgtggaacttt
ccgctcgcaatgggcacccgcaagatcgcgcccgcgctcgccgccggctgcaccatggtg
gtcaagccggcccccgaaactccgctcaccatgctgctgctcggccggatgttcgccgag
gccggcctgccgcccggtgtgctgtcgatcctgccgaccgcacgcgcggccgaattgacc
ggccccctgctcaccgatccgcgcctgcgcaaggtcaccttcaccggttccaccgccgtg
ggcaagctcctgctcgcccgatccgccgaccggatgctgcgcacgtcgatggagctcggc
ggcaacgccccattcgtggtgttcgccgacgcggacctcgatgcggcggtggacggcgcg
atggccgccaagatgcgcaataccggcgaggcctgcaccgcggccaaccgtttccacgtc
gacaatgcggtgcgcgcggagttcaccgcgaaactcaccgcccgcatgctcgcactgaag
ctcgggcccggtcacctcgacggtgtccaggtcgggccgctgatcaacgagcgacagcga
aacacggtctccgacttggtactcgacgccgtggcgaagggggcggtcgtcaccaccggc
ggtcacagcctgcccggcgaaggattcttctacgcgcccaccgtcctcgccgacgtcccc
gccgacgcccgcatcctgcgcgaggaggtcttcggccccgtcgccgcgatcaccggtttc
gacggcgaaaccgcaggggtcgaagccgcgaacgacaccgaattcggcttggccgcttac
atttacaccaaagatctggatcgagccctccgtgtcgccgaagcggtcgagtccggcatg
gtcggcgtcaaccgcggcatcgtctccgacgtcgcggcccctttcggcggcatgaagcaa
tccggcctgggccgcgaggcgggcaccgaaggcatcgaggagtacctcgaaaccaaatac
ctcgcgttgcgctga

KEGG   Nocardia brasiliensis: O3I_026075Help
Entry
O3I_026075        CDS       T02270                                 

Gene name
gabD2
Definition
(GenBank) succinic semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00250  Alanine, aspartate and glutamate metabolism
nbr00310  Lysine degradation
nbr00350  Tyrosine metabolism
nbr00650  Butanoate metabolism
nbr00760  Nicotinate and nicotinamide metabolism
nbr01100  Metabolic pathways
nbr01120  Microbial metabolism in diverse environments
Module
nbr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    O3I_026075 (gabD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O3I_026075 (gabD2)
   00310 Lysine degradation
    O3I_026075 (gabD2)
   00350 Tyrosine metabolism
    O3I_026075 (gabD2)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    O3I_026075 (gabD2)
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     O3I_026075 (gabD2)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     O3I_026075 (gabD2)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     O3I_026075 (gabD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFU03164
UniProt: K0F181
Position
complement(5950961..5952514)
Genome map
AA seq 517 aa AA seqDB search
MPAPEAAVFDRLSGLAAIDNPDERARKTIAETFSGKPLGSVPVGTADDVAAAFEKARAAQ
TRWAARSAADRAAVLERYRALVVKHREFLMDVVQAETGKARWAAQEEIMGLMFAARYFAK
AAPGLLGAHSVPGAFPVLNRTSVRHQPKGVVGVVAPWNYPMLLSIGDSIPALIAGNAVVV
KPDSQTPFSSLANAELLYRAGLPRDLLAVVPGPGTVVGTAIVDSCDYLMFTGSSATGRTL
AEQCGRRLIGFSAELGGKNPMIVAQGANLDKVAKAAVRACFSNAGQLCISIERLYVERSI
ADEFTEKFVAAVEAAKLGAAYDYSADIGSLISEAQLETVTKHVADATSKGAKVLAGGKAR
PDLGPLFYEPTVLAEVTDEMECGRNETFGPLVSIYPVDSVADAIRLANDTEYGLNASVWA
ANKSAGERIAEQLHAGTVCVDEGYAPAWGSTAAPMGGMGISGVGRRHGPDGLLKFTEPQT
VVVTRFLNLDAPPLVSQDKWQRFLMSVARSLRFLPGR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgccggaagccgccgtcttcgaccgtctgagcgggctcgccgcgatcgacaat
ccggacgagcgtgcgcgtaagacgatcgccgagacgttcagcggtaagccgctcggcagc
gtgccggtcggcaccgccgacgacgtggcggccgcgttcgagaaggccagagccgcgcag
acgcgctgggcggcgcgttcggccgccgatcgcgccgcggtgctggaacgctaccgcgcg
ctcgtggtgaagcaccgcgaattcctgatggacgtggtgcaggccgagaccggcaaggcc
cgctgggcggcgcaggaagagatcatgggcctgatgttcgcggcccgctacttcgccaag
gccgcacccggcctgctcggcgcgcacagcgtgcccggcgcgttcccggtgctgaatcgc
acgtcggtgcgccatcagcccaagggcgtcgtcggtgtggttgcgccgtggaactacccg
atgctgctgtccatcggcgattcgatccccgcgctcatcgcgggcaacgccgtggtggtc
aagccggacagccagaccccgttctcctcgctggccaacgccgagctgctctaccgcgcc
ggcctgccacgggacctgctcgcggtggtcccgggaccgggcaccgtggtcggcaccgcg
atcgtggacagctgcgactacctgatgttcaccggttcctccgcgaccggccgcaccctg
gccgaacagtgcggacgcaggctcatcggcttctccgccgaactcggcggcaagaacccg
atgatcgtggcgcagggcgcgaacctggacaaggtcgccaaggcggcggtgcgggcctgt
ttctccaacgcgggccagctgtgtatctcgatcgaacggctctacgtggaacggtcgatc
gccgacgagttcaccgagaagttcgtcgccgccgtcgaggcggcgaaactcggtgcggcc
tacgactattcggccgatatcggctcgctcatctccgaggcccagctggagacggtgacc
aagcatgtcgccgacgccacgtccaagggcgcgaaggtgctcgccggtggcaaggcccgg
ccggacctgggcccgctcttctacgagccgaccgtcctcgccgaggtcaccgacgagatg
gaatgcggccgcaacgagacgttcggcccgctggtctcgatctatccggtcgacagtgtc
gccgacgcgatccggctcgccaacgacaccgaatacggcctgaacgccagtgtctgggcc
gcgaacaagtccgcgggggagcggatcgccgagcagttgcacgccgggaccgtctgcgtg
gacgagggttacgctcccgcgtggggcagcaccgccgcgccgatgggcggcatgggcatc
tccggcgtcgggcgcaggcacggcccggacggactgctcaagttcaccgagccgcagacc
gtcgtcgtcacccggttcctgaatctcgatgcgcccccgctggtttcgcaggacaagtgg
cagcggttcctgatgtcggtcgcgcgcagcctgcggttcctgcccggacgctga

KEGG   Nocardia brasiliensis: O3I_027170Help
Entry
O3I_027170        CDS       T02270                                 

Gene name
gabD2
Definition
(GenBank) succinic semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00250  Alanine, aspartate and glutamate metabolism
nbr00310  Lysine degradation
nbr00350  Tyrosine metabolism
nbr00650  Butanoate metabolism
nbr00760  Nicotinate and nicotinamide metabolism
nbr01100  Metabolic pathways
nbr01120  Microbial metabolism in diverse environments
Module
nbr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    O3I_027170 (gabD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O3I_027170 (gabD2)
   00310 Lysine degradation
    O3I_027170 (gabD2)
   00350 Tyrosine metabolism
    O3I_027170 (gabD2)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    O3I_027170 (gabD2)
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     O3I_027170 (gabD2)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     O3I_027170 (gabD2)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     O3I_027170 (gabD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFU03383
UniProt: K0EUD3
Position
complement(6202680..6204251)
Genome map
AA seq 523 aa AA seqDB search
MTTASPLAAADALPSALVQPLLERAVAGGAPAVEVFAPATGRKIADLPQSSVADIDRAFA
TARAVQQEWARRPVRERAAVLRRFHDIVLAEQDVVLDIVQTETGKSRAHAFDEVGDVAVN
ARYYAQVAPKLLATRKPRGVLPVLTRVDVRHRPKGVVAVISPWNYPLALAVSDALPALVA
GNAVVARPDNQTALIALWAIDAAERAGLPKGLWQAVLGRGSVIGGEVIGRADYVDYTGSS
ATGRTIARQAGERLIGYSLELGGKNPLVVLADADVARAAKIAIRACFASAGQLCESMERI
YVHEKVYDQFVREFVGHVEKITLGADLNFDSDMGSLTFPRQLDTVRTHVEDAVAKGATVL
AGGRARPELGPYFYEPTVLSGVRPGMTVYREETFGPVVSIYRVASDDEAVEQANDTAYGL
NASVWTKDTERGRAVAARINAGSVNVNEGFIAAWGSADAPSGGLGISGTGRRHGPEGLLK
YIDTQTIAVQRVLPIAPLPGMSEQLWAKTMTLYFGVMKTLRQK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgcctccccgctggctgccgccgacgccctgccgtcggcgctggtccagccc
ctgctcgagcgtgccgtcgcgggcggcgcgcccgccgtcgaggtgttcgcccccgccacc
ggacgcaagatcgccgatctgccccagtcctcggtcgccgatatcgaccgcgccttcgcg
accgcgcgggcggtgcagcaggaatgggcgcgccgcccggtccgggagcgggccgccgtg
ctgcgtcgcttccacgacatcgtgctggccgagcaggatgtcgtgctcgacatcgtgcag
accgagaccggcaagtcccgggcgcacgccttcgacgaggtcggcgatgtcgcggtcaat
gccaggtactacgcgcaggtcgccccgaaactgctcgccacccgcaagccacgcggtgtg
ctgccggtgctgacccgggtcgacgtgcggcaccgcccgaagggcgtggtcgcggtcatc
tcaccgtggaactacccgctcgccctcgccgtctccgacgcgctgcccgccctggtcgcg
ggcaacgcggtggtggcgcgaccggacaaccagaccgcgctcatcgcgctgtgggcgatc
gacgccgccgaacgggccgggctgccgaaagggttgtggcaggcggtactcggccgcggt
tcggtgatcggcggcgaggtgatcggccgcgcagactatgtcgactacaccggttccagc
gccaccggccgcaccatcgcgcgacaggcgggcgagcggctcatcggctactcgctcgaa
ctcggcgggaagaacccgctggtggtgctggccgacgccgacgtggcgcgggcggccaag
atcgccattcgcgcctgcttcgcgtcggccgggcagctctgcgaatcgatggagcgaatc
tatgtgcacgagaaggtatatgaccagttcgtccgcgaattcgtcgggcacgtcgagaaa
attacgctcggcgcggacctgaacttcgacagcgacatgggctcgctcaccttcccacgc
caattggacacggtccgaacgcatgtcgaggacgcggtggccaagggcgcgacggtgctc
gcgggcggccgggcgcgccccgagctggggccgtacttctatgagccgaccgtgctgagc
ggggtgcgtcccggtatgacggtgtatcgcgaggaaaccttcggcccggtcgtctcgatc
tatcgggtcgccagtgacgacgaggcggtcgaacaggccaacgacaccgcctacggcctc
aacgccagcgtgtggacgaaggacaccgagcggggccgcgcggtcgcggcccggatcaac
gccggatcggtgaacgtcaacgagggcttcatcgcggcctggggcagtgccgacgcgccg
tcgggcggactcggcatctccggcaccggtcgccggcacggccccgagggcctgctgaaa
tacatcgacacccagaccatcgcggtgcagcgggtgctgccgatcgcgccgttgcccggc
atgtccgaacagctgtgggccaaaaccatgacgctctacttcggcgtcatgaaaacactg
cgccagaaatga

KEGG   Nocardia brasiliensis: O3I_030440Help
Entry
O3I_030440        CDS       T02270                                 

Definition
(GenBank) putative succinate-semialdehyde dehydrogenase [NADP+] (SSDH)
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00250  Alanine, aspartate and glutamate metabolism
nbr00310  Lysine degradation
nbr00350  Tyrosine metabolism
nbr00650  Butanoate metabolism
nbr00760  Nicotinate and nicotinamide metabolism
nbr01100  Metabolic pathways
nbr01120  Microbial metabolism in diverse environments
Module
nbr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    O3I_030440
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O3I_030440
   00310 Lysine degradation
    O3I_030440
   00350 Tyrosine metabolism
    O3I_030440
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    O3I_030440
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     O3I_030440
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     O3I_030440
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     O3I_030440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 DUF3102 LuxC
Motif
Other DBs
NCBI-ProteinID: AFU04037
UniProt: K0F2T5
Position
complement(6913343..6914812)
Genome map
AA seq 489 aa AA seqDB search
MLTETLSAAERAVIDTVPTGLYIDGQWCATNAELPVLDPATGAVLCAVADASPQDGLDAL
TAAHQAQADWAATPPRARADLLMRAHHALLDDTDRLALIMTLEMGKPLAEARGEIAYAAE
FFRWFAEEAVRSDGGYLPAPAGGSRFLVTKQPVGPSLLITPWNFPMAMGARKIAPALAAG
CTCVVKPAEQTPLSMLALADLLHRAGLPRGVVNVLTTADPGALMTPLILDERSRKLSFTG
STAVGKRLLEQCARTVMRTSMELGGNAAFIVFDDADLDEAVEGALAAKMRNIGQACTAAN
RIFVQRGVVDEFAARLAERMAALPMGRGTEPGVVVGPLIDADAVTKVTELVADARRRGAR
VLTGGTVLDGPGNFYPATVLIGVPDDAAMCHTEIFGPVASITTFDTEDEVVARANNTPYG
LVGYVFTEHLRRGLRVCEALETGMVGLNQGVVSNPAAPFGGVKESGLGREGGMIGIDEFL
ETKYIGVRL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgagaccttgtccgccgcggagcgggccgtaatcgacaccgtgccaacgggt
ttgtatatcgacgggcagtggtgcgcgacgaatgccgaactgcccgtactggatccggcc
accggcgccgtgttgtgcgcggtcgccgacgcgagcccgcaggacgggctcgacgcgttg
accgcggcgcaccaggcccaggcggactgggcggcgacaccgccgcgagcccgcgccgat
ctgctcatgcgcgcgcaccacgcgctgctcgacgacaccgaccggctcgcgctgatcatg
acgctggagatgggcaagccgctcgccgaggcccgcggcgaaatcgcttatgccgcagag
ttcttccgctggttcgccgaggaagccgtccgttcggacggtggctatctgcccgcgccc
gcgggcggttcccgcttcctggtgaccaagcagccggtgggaccgagcctgctgatcaca
ccctggaacttcccgatggccatgggcgcgcgcaagatcgcgcccgccctcgccgccggc
tgcacctgtgtggtgaaacccgctgagcagacgccgttgtcgatgctcgcgctcgccgac
ctgcttcatcgcgccgggctgccgcgcggcgtcgtcaacgtgctgaccaccgccgacccc
ggcgcgctgatgacgccgctgatcttggatgagcgctcgcgcaaactgtccttcaccggg
tccaccgccgtcggcaaacgcctgctcgaacagtgtgcgcgcacggtcatgcgcacctcg
atggagctcggcggcaacgcggcgttcatcgtgttcgacgatgcggacctggacgaggcc
gtcgagggcgcgctcgccgccaagatgcgcaatatcgggcaggcctgcaccgcggcgaac
cgaatcttcgtgcagcgcggcgtcgtcgacgagttcgccgcccggctcgccgagcggatg
gcggccttgccgatggggcgtggcaccgagcccggagtcgtcgtcgggccgctgatcgac
gccgacgcggtcacgaaggtcaccgaactcgtcgccgacgcgcgccgccgcggcgcgcgg
gtgctcaccggcggcaccgtgctcgacgggcccggcaacttctatccggcgacggtgctg
atcggcgtgcccgacgatgcggcgatgtgccacaccgagatcttcggtccggtcgcctcg
atcacgaccttcgacaccgaggacgaggtggtcgcccgcgccaacaacacgccctacggt
ctggtcggctacgtcttcaccgagcacctgcgccgcggcctgcgggtgtgcgaggccttg
gaaaccggcatggtcgggctcaaccagggcgtggtgtccaacccggccgcaccgttcggc
ggggtcaaggaatccgggctcggccgcgaaggcgggatgatcggcatcgacgaattcctc
gagaccaaatacatcggagtgcgactgtga

KEGG   Nocardia brasiliensis: O3I_037715Help
Entry
O3I_037715        CDS       T02270                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00250  Alanine, aspartate and glutamate metabolism
nbr00310  Lysine degradation
nbr00350  Tyrosine metabolism
nbr00650  Butanoate metabolism
nbr00760  Nicotinate and nicotinamide metabolism
nbr01100  Metabolic pathways
nbr01120  Microbial metabolism in diverse environments
Module
nbr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    O3I_037715
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O3I_037715
   00310 Lysine degradation
    O3I_037715
   00350 Tyrosine metabolism
    O3I_037715
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    O3I_037715
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     O3I_037715
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     O3I_037715
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     O3I_037715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF3102
Motif
Other DBs
NCBI-ProteinID: AFU05490
UniProt: K0F7Y5
Position
complement(8454135..8455589)
Genome map
AA seq 484 aa AA seqDB search
MVSEREVLESVPTQLWIGGPVAATGGGTFPVHNPATGEVLAQVADATPEDAVRALDAAVA
VQADWAARPSRERGEILRTVFEQITARAEEFALLMTLEMGKALPESRNEVKYGAEFFRWF
SEEAVRVHGRYLHAPSGTGRIMVHKQPVGPCLAITPWNFPLAMGTRKIGPALAAGCTMIV
KPASATPLTMLALARLCSEAGLPDGVLSVITSSRSGAVTQPLIDDPRLRKLTFTGSTEVG
KKLVQSSANGLLRTSMELGGNAPFVVFDDADVDAAVQGAMLAKLRNGGEACTAANRFHVQ
QGVLEEFTTKLVEAMSNSVVLGPGTDPDTTLGPLINEEQLDTVSALVEDAVAKGAQLRLG
GKAPGGPGWFYPATILTDVPAQARILTEEVFGPVAPIVGFSTEEQGLAAANDTEFGLVSY
VYTRDLDRALRVAEGLESGMVGINRGVISDPAAPFGGVKASGFGREGGTEGIEEYLSTKY
IALT
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccgaacgcgaagttctcgaatccgtcccgacgcaactgtggatcggtgggccc
gtcgcggccaccggtggcggcaccttcccggtgcacaatccggcgaccggggaggtgctg
gcccaggtcgccgacgcgacacccgaagacgcggtgcgcgcgctggacgcggccgtcgcc
gtgcaggccgattgggcggcgcggccctcgcgcgagcgcggcgagatcctgcgcaccgtg
ttcgagcagatcaccgcgcgggccgaggaattcgcgctgctgatgaccctggaaatgggc
aaggcgctgccggagagccgcaacgaggtcaaatacggcgcggagttcttccgctggttc
agcgaggaagccgtgcgggtgcacggccgctacctgcacgcgccctccggcaccggccgg
atcatggtgcacaagcagccggtcgggccgtgcctggcgatcacgccgtggaacttcccg
ctggccatgggcacccgcaagatcggcccggcgctggccgcgggctgcaccatgatcgtc
aaacccgcctcggcgaccccgctgacgatgctggcgctggcccggctgtgcagcgaggcc
gggctgcccgacggggtgctctcggtgatcacgtcgagccgttccggtgcggtcacccag
ccgctgatcgatgatccgcggttgcgcaagctcaccttcaccggctccaccgaggtgggc
aagaaactggtgcagagctcggccaacggtctgctgcgcacctcgatggaactcggcggc
aacgcgccgttcgtggtgttcgacgacgccgacgtcgacgcggccgtccagggcgcgatg
ctggcgaaactgcgcaacggcggcgaggcgtgcaccgcggccaaccgcttccacgtgcag
cagggggtgctcgaggagttcaccaccaaactggtcgaggcgatgagcaacagcgttgtc
ctcggccccggcaccgacccggacaccaccctcggcccgctgatcaacgaagaacagctc
gacaccgtcagcgcgctcgtcgaggacgccgtggccaagggcgcccagctccggctcggc
ggcaaggccccgggcggccccggctggttctaccccgcgaccatcctcaccgacgtgccg
gcccaggccaggatcctcaccgaagaggtgttcggaccggtcgcgccgatcgtcggcttc
agcaccgaggagcagggcctcgccgccgccaacgacaccgagttcggcctcgtcagctac
gtctacacccgcgacctcgaccgcgccctgcgcgtcgccgagggcctcgaatccggcatg
gtcggcatcaaccgcggcgtaatctccgaccccgcagcgcctttcggcggcgtcaaagcc
tccggcttcggccgggagggcggcaccgaaggtatcgaggaatacctctccaccaagtac
atcgccctcacctga

DBGET integrated database retrieval system