KEGG   Nocardia brasiliensis: O3I_015660Help
Entry
O3I_015660        CDS       T02270                                 

Definition
(GenBank) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00260  Glycine, serine and threonine metabolism
nbr00750  Vitamin B6 metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01230  Biosynthesis of amino acids
Module
nbr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    O3I_015660
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    O3I_015660
Enzymes [BR:nbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     O3I_015660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFU01093
UniProt: K0EN93
Position
complement(3502528..3503676)
Genome map
AA seq 382 aa AA seqDB search
MNSSAEPFLYDRSGRRYEISSPRWRGDDGTPLAVSPMPGIDPEQIVTSERSLWRYQAVIP
VPARHRISLGEGATPMVPLDWDGRRVHFKLEWFNPTSSFKDRGVAVMMSHLAGQGVTKVL
EDSSGNGGSAVAAYCAAAGLGAKILVPELTSAAKILQAKAYGAEIELVAGTRDEVAAAAI
RQSARLTYASHNWHPFFLQGTKTVAYEMWEDLGFRAPDNVVLVAGAGSNVLGCDIAFGEL
LGAGRIERLPRLLIGQPEHWATIADTCNGLDPADRGPREPTIAEGAAIADPVRLPEAVAA
IRRSGGAAVAVPDSAIGAAVGKLAARGLYAEPTSCVAVAALDHFLAEGVIAADETTVVVL
TGSGLKSSEQMARVFDRSPAVE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcttctgccgaaccgttcctctacgaccgttcgggtcgccgctatgagatctcg
agcccgcgctggcgcggtgacgacggcactcccctggccgtcagccccatgccgggtatc
gacccggagcagatcgtgacgtccgaacgctcgctgtggcggtatcaggcggtgatcccg
gttccggcgcggcatcggatcagcctcggcgaaggtgcgacgccgatggtgccgctcgac
tgggatggccggcgggtgcacttcaaactcgaatggttcaaccccacttcgagtttcaag
gatcgcggggtcgcggtgatgatgtcgcacctggccggtcagggcgtcacgaaggtcctc
gaggacagttccggcaacggcgggtccgcggtcgccgcctattgcgcggccgccggactc
ggcgccaagatcctcgtgcccgagctgacctcggccgcgaagatactgcaggccaaggcc
tatggcgccgagatcgaactggtggcgggcacccgcgacgaggtggccgccgcggcgatc
cgccagtccgcgcggctgacctacgccagccacaactggcatccgttcttcttgcagggc
accaagaccgtcgcctacgagatgtgggaggacctcggcttccgcgcacccgacaatgtc
gtgctcgtcgccggcgccggcagcaacgtgctcggctgcgatatcgcgttcggcgaattg
ctcggggcgggccggatcgaacgcctgccgcggctgctgatcggccagcccgaacactgg
gccaccatcgccgacacctgcaacggcctcgacccggccgaccgtggaccacgcgaaccc
acgatcgccgagggcgccgccatcgccgacccggtccggttacccgaggcagtcgcggcg
atccgccgttccggcggcgcggccgtcgccgttcccgattcggcgatcggagccgcggtg
ggcaagctcgcggcgcgtgggctctacgccgaacccaccagctgcgtcgccgtcgccgca
ctggatcactttctcgccgaaggcgtcatcgccgccgacgagaccaccgtcgtcgtgctc
accggttccggactcaaatcgtcggagcagatggcccgcgtcttcgaccggtcaccggcg
gtcgagtga

DBGET integrated database retrieval system