KEGG   Nocardia brasiliensis: O3I_016290Help
Entry
O3I_016290        CDS       T02270                                 

Definition
(GenBank) tartrate dehydrogenase
  KO
K07246  tartrate dehydrogenase/decarboxylase / D-malate dehydrogenase [EC:1.1.1.93 4.1.1.73 1.1.1.83]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00630  Glyoxylate and dicarboxylate metabolism
nbr00650  Butanoate metabolism
nbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    O3I_016290
   00650 Butanoate metabolism
    O3I_016290
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.83  D-malate dehydrogenase (decarboxylating)
     O3I_016290
    1.1.1.93  tartrate dehydrogenase
     O3I_016290
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.73  tartrate decarboxylase
     O3I_016290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AFU01219
UniProt: K0EVX3
Position
complement(3634320..3635426)
Genome map
AA seq 368 aa AA seqDB search
MGATHRIAVIPGDGIGKEVVPQGIRVLSAAAAAFDFTLDITEFDFASADYYTATGKMLPD
GWFDQLSVFDALFFGAVGWPEVVPDHISLWGSLLQFRRHFDQYVSLRPVRLLPGISSPLA
GRRPGDVDFYVVRENTEGEYSSVGGKIFEGTDRETVLQETVMTRTGVDRILKYAFELAQR
RPKRHLTSATKSNGISISMPYWDERVADMAGSYPDVAVDKYHIDILTANFVLHPDWFDVV
VASNLFGDILSDLGPACTGTIGIAPSGNINPERRFPSLFEPVHGSAPDIAGLGIANPIGQ
IWSGAMMLEHLGEDAAAAAVLAAVEAALVQDRSAMTPDMGGSGTTESFGALVCAQLEAAT
SMTAARRA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccacacaccgaattgctgtcattccgggcgacggcatcggcaaggaagtcgtg
ccgcagggaattcgagttctctcggccgcggcggccgcattcgacttcaccctggatatc
accgagttcgatttcgcgagcgcggattactacacggcgaccgggaaaatgctgccggac
ggctggttcgaccagctgtccgtcttcgacgcgctcttcttcggcgccgtcggctggccc
gaggtggtgcccgaccacatctcgctgtggggcagcctgttgcagttccgccgccatttc
gaccagtacgtgagcctgcgcccggtccggctgctaccgggcatcagcagcccgctcgcc
gggcggcggcccggcgacgtcgacttctacgtggtccgggagaacaccgagggcgaatac
tcgagcgtcggcggcaagatcttcgagggcaccgaccgggaaacggtgctgcaggagacc
gtgatgaccagaaccggcgtcgatcgaatcctgaagtacgcgttcgaactagcgcaacgc
aggccgaaacgacacctcacctccgcgacgaagagcaacggcatttccatctccatgccc
tattgggacgaacgcgtcgccgacatggcgggcagttatcccgacgtggcggtggacaag
taccacatcgatattctgacggcgaatttcgtcttgcatccggactggttcgacgtggtg
gtcgcgagcaatctcttcggcgatatcctgtccgatctcgggcccgcctgcaccggcacc
atcggcatcgcgccgagcgggaacatcaaccccgagcggcgttttccgagtctgttcgag
ccggtgcacggttcggcgcccgatatcgccgggctggggatcgccaaccccatcggccag
atctggagcggcgcgatgatgctggagcatctgggcgaggacgcggccgccgcggcggtg
ctcgccgcggtcgaagccgcgctcgtgcaggacaggtccgcgatgacaccggatatgggc
gggtccgggaccacggagtccttcggtgccctggtctgcgcgcagctcgaggcggccacc
tcgatgaccgcggcgaggcgagcatga

KEGG   Nocardia brasiliensis: O3I_030435Help
Entry
O3I_030435        CDS       T02270                                 

Definition
(GenBank) Tartrate dehydrogenase/decarboxylase (TDH) (D-malate dehydrogenase [decarboxylating])
  KO
K07246  tartrate dehydrogenase/decarboxylase / D-malate dehydrogenase [EC:1.1.1.93 4.1.1.73 1.1.1.83]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00630  Glyoxylate and dicarboxylate metabolism
nbr00650  Butanoate metabolism
nbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    O3I_030435
   00650 Butanoate metabolism
    O3I_030435
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.83  D-malate dehydrogenase (decarboxylating)
     O3I_030435
    1.1.1.93  tartrate dehydrogenase
     O3I_030435
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.73  tartrate decarboxylase
     O3I_030435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AFU04036
UniProt: K0F962
Position
complement(6912270..6913346)
Genome map
AA seq 358 aa AA seqDB search
MTAPRYRIATIPGDGIGVDVTAAAVSVLDTVLPGLEWTEFDWSCANYLTTGRMMPPDGPE
LLAGFDAILLGAVGFPGVPDHVSLWGLLIPLRRAFGQYVNLRPVRLLPGTESALRGRSAE
ELDILIVRENSEGEYSEIGGTHNPGRADEFVLQESVFTRVGCERIIRYAFERARERGGRL
CSATKSNGLIHSMPYWDSVFERIAADYPDVQTRQMHVDALAAEIVLHPDRLDVIVGSNLF
GDILSDLAAAVTGGLGLAPSGNINPERTAPSMFEAVHGSAPDIAGQGIADPIAQILAGAM
LLDHLGETAAAAAVDRAVCDVLGKGEVRTPDLGGDATTTELAAAIADRAAELVADPPR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcgcccaggtaccgcatcgcgaccatccccggcgacggcatcggggtggacgtc
accgccgctgccgtctcggtgctcgacaccgtgctgcccggtctcgagtggaccgaattc
gactggtcctgcgcgaattatctgaccaccggccggatgatgccgcccgacggtcccgaa
ctgctcgccggcttcgacgcgatcctgctcggcgccgtcggctttcccggtgtgcccgac
catgtttcgctgtggggcctgctgattccgttgcgccgtgcgttcggtcagtacgtcaat
ctgcggccggtccggttgctgcccggcaccgagtcggccctgcgcggacgcagcgccgag
gagctggacatcctcatcgtgcgggagaactccgagggcgagtactccgagatcggcggc
acgcacaatccgggccgcgcggacgaattcgtgctccaggagtcggtgttcacccgggtc
gggtgtgaacggatcatccggtacgcgttcgagcgggcccgggaacgcggcggccggttg
tgctcggccaccaaatcgaacggcctgatccactcgatgccgtactgggacagcgtgttc
gaacggatcgccgccgactaccccgatgtgcagaccaggcagatgcacgtggacgcgctc
gcggcggagatcgtgctgcacccggaccggttggacgtgatcgtgggttcgaacctgttc
ggcgacatcctgtccgacctcgccgcggccgtgaccggcggcctcgggctcgccccctcg
ggcaatatcaaccccgagcgcaccgcgccgtcgatgttcgaggcggtgcacggcagcgcg
cccgatatcgcgggccagggcatcgccgatccgatcgcccagatcctcgcgggcgccatg
ctgctcgaccacctcggcgaaaccgccgcggcggccgcggtggaccgggcggtgtgcgac
gtactcggcaaaggcgaagtgcgcacgccggatctgggcggcgacgcgaccacgacggaa
ctcgccgccgccatcgcggaccgtgctgccgaactggtcgccgacccaccccgctga

DBGET integrated database retrieval system