KEGG   Nocardia brasiliensis: O3I_028050Help
Entry
O3I_028050        CDS       T02270                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00010  Glycolysis / Gluconeogenesis
nbr00051  Fructose and mannose metabolism
nbr00562  Inositol phosphate metabolism
nbr00710  Carbon fixation in photosynthetic organisms
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
nbr01230  Biosynthesis of amino acids
Module
nbr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nbr_M00002  Glycolysis, core module involving three-carbon compounds
nbr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_028050 (tpiA)
   00051 Fructose and mannose metabolism
    O3I_028050 (tpiA)
   00562 Inositol phosphate metabolism
    O3I_028050 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    O3I_028050 (tpiA)
Enzymes [BR:nbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     O3I_028050 (tpiA)
Exosome [BR:nbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   O3I_028050 (tpiA)
  Exosomal proteins of bladder cancer cells
   O3I_028050 (tpiA)
  Exosomal proteins of melanoma cells
   O3I_028050 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM TMP-TENI
Motif
Other DBs
NCBI-ProteinID: AFU03559
UniProt: K0F228
Position
complement(6387034..6387819)
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHLEAIALVQKIAFALPEKYFAKVDVTVVPPFTDLRSVQTLVEGD
KLLLTYGAQDLSRHDAGAYTGEISGAMLAKLGCTYVVVGHSERRQYHGEDDATVLAKAKQ
ALKHGITPIVCIGEGLDVREAKTHVEYNLEQLRGSLKGLTAEEISKIVIAYEPVWAIGTG
KVATPADAQEVCGAIRGELVELASAEVAADLRVLYGGSVNAKNIGELIKQTDIDGALVGG
ASLKGDEFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagccgctcatcgcgggcaactggaagatgaacctcaatcacctcgaggcc
atcgctctggtgcagaagatcgcgttcgccctgccggagaagtacttcgccaaggtcgac
gtcaccgtcgtgccgccgttcaccgatctgcgcagtgtgcagaccctggtggagggcgac
aagctcctgctcacctatggggcgcaggatctttcgcgccacgatgccggcgcctacacc
ggtgagatcagcggcgccatgctggcgaagctgggttgcacctatgtggtggtcgggcat
tcggagcggcggcagtaccacggcgaggacgacgccactgtgctcgccaaggccaagcag
gcgctcaagcacggaatcaccccgatcgtctgcatcggcgagggtctggatgtgcgcgag
gcgaagacacatgtcgagtacaacctcgagcagctgcggggttcgctgaaaggcctgacg
gcggaggagatctcgaagatcgtcatcgcctacgagccggtctgggcgatcggcaccggc
aaggtcgccaccccggccgacgcgcaggaagtgtgcggggccatccgcggcgagctggtc
gaactcgcctccgcggaggtggcggcggacctgcgggtgctctacggcggttcggtcaac
gccaagaacatcggcgagctgatcaagcagaccgatatcgacggcgcgctggtcggcggc
gcttcgctgaagggtgacgagttcgccaccctgtccgcgatcgccgcgggcggcccactg
ccgtaa

DBGET integrated database retrieval system