KEGG   Nocardia brasiliensis: O3I_028060Help
Entry
O3I_028060        CDS       T02270                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00010  Glycolysis / Gluconeogenesis
nbr00710  Carbon fixation in photosynthetic organisms
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
nbr01230  Biosynthesis of amino acids
Module
nbr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nbr_M00002  Glycolysis, core module involving three-carbon compounds
nbr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_028060
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    O3I_028060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nbr04131]
    O3I_028060
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nbr04147]
    O3I_028060
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     O3I_028060
Membrane trafficking [BR:nbr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    O3I_028060
Exosome [BR:nbr04147]
 Exosomal proteins
  Proteins found in most exosomes
   O3I_028060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N NAD_binding_3 Semialdhyde_dhC DapB_N
Motif
Other DBs
NCBI-ProteinID: AFU03561
UniProt: K0F7U4
Position
complement(6389042..6390061)
Genome map
AA seq 339 aa AA seqDB search
MTVRVGINGFGRIGRNFFRAVEAQKALGTTDIEIVAVNDLTDNATLATLLKYDSILGRLP
QDVSLDGDDTIVVGDQRIKALAIKEGPAALPWGDLGVDVVVESTGIFTDATKAKGHLAAG
AKKVIISAPAKGEDLTVVMGVNDEKYDGSQNIISNASCTTNCLGPLAKVLNDSFGIERGL
MTTIHAYTQDQNLQDGPHSDLRRARAAALNIVPTGTGAAKAIGLVLPELQGKLDGYALRV
PVPTGSVTDLTVTLRTAASIDEINAAYKAAAEGPLKGILKYNVDPIVSSDIVTDPHSSIY
DAPLTKVIDDQVKVVSWYDNEWGYSNRLADLIGLVGKSL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtccgggtaggcatcaacggcttcggtcgtatcggacgtaacttcttccgggcg
gtggaggcgcagaaggcgctgggcaccaccgacatcgagatcgtcgcggtcaacgacctc
accgacaacgcgacgctcgcgaccctgctcaagtacgactcgatcctgggccgcttgccg
caggacgtctcgctcgacggcgatgacaccatcgtggtcggtgaccagcggatcaaggcg
ctggccatcaaggagggcccggcggcgctgccgtggggcgacctgggtgtcgacgtggtg
gtcgagtccacgggcatcttcaccgacgcgaccaaggccaagggtcacctcgcggccggt
gccaagaaggtcatcatctccgcgcccgccaagggcgaggacctgaccgtcgtcatgggc
gtcaacgacgagaagtacgacggcagccagaacatcatctccaacgcctcgtgcaccacc
aactgcctcggcccgctggcgaaggtgctgaacgacagcttcggcatcgagcgtggtctg
atgaccaccatccacgcctacacgcaggaccagaacctgcaggacggcccgcacagcgac
ctgcgtcgcgcccgcgccgccgcgctgaacatcgtgccgaccggcaccggcgccgccaag
gccatcggcctggtgctgccggagctgcagggcaagctcgacggttacgcgctgcgcgtg
ccggtcccgacgggttcggtcaccgacctcaccgtcaccctgcgcaccgccgcatcgatc
gacgagatcaacgccgcctacaaggccgccgccgagggcccgctgaagggcatcctcaag
tacaacgtcgacccgatcgtgtcgagcgacatcgtcaccgatccgcactcctcgatctac
gacgcgccgctcaccaaggtgatcgacgaccaggtcaaggtcgtgtcctggtacgacaac
gagtggggttactcgaaccgtctcgccgacctcatcggcctcgtcggcaagtcgctctga

DBGET integrated database retrieval system