KEGG   Nocardia brasiliensis: O3I_028530Help
Entry
O3I_028530        CDS       T02270                                 

Definition
(GenBank) 2-oxoglutarate ferredoxin oxidoreductase subunit alpha
  KO
K00174  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit alpha [EC:1.2.7.3 1.2.7.11]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00010  Glycolysis / Gluconeogenesis
nbr00020  Citrate cycle (TCA cycle)
nbr00620  Pyruvate metabolism
nbr00650  Butanoate metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Module
nbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_028530
   00020 Citrate cycle (TCA cycle)
    O3I_028530
   00620 Pyruvate metabolism
    O3I_028530
   00650 Butanoate metabolism
    O3I_028530
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     O3I_028530
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     O3I_028530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N POR TPP_enzyme_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: AFU03655
UniProt: K0F3F0
Position
6495095..6497116
Genome map
AA seq 673 aa AA seqDB search
MVSHQNDVGTSHSAAGTAQSGTGAAKLEKVVIRFAGDSGDGMQLTGDRFTHEAAAFGNDL
ATQPNFPAEIRAPQGTLPGVSSFQIQIADYDILTAGDQPDVLVAMNPAALKANLEDLPRG
ATLIVNTDEFTKRTLAKVGYAADPLDDDTLSDFVVHRVPMTSLTMGATESAGVGKKDGQR
AKNMFALGLLSWMYGRPIGGTEQFMREKFAAKPEIAEANVLAFRAGWNYGETTESFATTY
EIAPAKLPPGTYRQITGNTALAYGLVTAGQLAGLPVFLGTYPITPASDILHELSKHKNFG
VTTFQAEDEIAGIGAALGASLGGSLGVTSTSGPGLALKSETIGLAVMTELPLLVVDVQRG
GPSTGLPTKTEQADLLQALYGRNGESPVAVLAPRSPADCFATAVEAARIALTYRTPVLLL
SDGSIANGSEPWSIPNVADLPPIVPGFEPAGAETDPFQPYARDPETLARPLAVPGTKGRA
HRIGGLEKADGSGNISYDPANHELMVRLRQAKIDGISVPDLEVDDPDGHAELLIIGWGSS
YGPIGEACRRARRRGVPVAQAHLRHLNPLPANLGDVLRRYRTVVAPEMNGGQLALLLRGK
YLVDVRPWTKVAGTAFSAQELVGVIDAALDGSIEEMEHDKAFAARARATYTTQPDSSADR
AQPGDVRPTGGNE
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgcaccagaatgatgtcggcaccagccacagcgctgccggcacagcccaaagc
ggcacgggcgcagcgaaattggaaaaggtcgtgattcggttcgccggcgactccggcgac
ggtatgcagctgaccggagatcgcttcacgcacgaagcggccgcgttcggcaacgacctc
gccacccaacccaacttccccgccgagatcagagcgccacagggcacgctgcccggcgtc
tcgtcgttccagatccagatcgccgactacgacatcctgaccgcgggcgatcagccggac
gtgctcgtcgcgatgaatccggccgcgctcaaggcgaatctggaagatctgccgcgcggc
gccaccctcatcgtcaacaccgacgagttcaccaaacgcaccctcgccaaggtcggctac
gccgccgacccgctcgacgacgacacgctgtcggatttcgtggtgcaccgcgtcccgatg
acctcgctcaccatgggcgccaccgaatccgccggcgtcggcaagaaagacgggcagcgc
gcgaagaacatgttcgcgctcgggctgctgtcctggatgtacgggcgcccgatcggcggc
accgaacagttcatgcgggagaagttcgcggccaaaccggagatcgccgaggcgaacgtg
ctggcgttccgggcaggctggaattacggcgagaccaccgaaagcttcgccaccacttac
gaaatcgcgcccgcgaagctgccgcccggcacctaccggcagatcaccggcaacaccgcg
ctcgcctacgggctggtcacggcaggtcagctggccggactgccggtgttcctcggcacc
tacccgatcaccccggcctcggacatcctgcacgagctgagcaaacacaagaacttcggc
gtcaccaccttccaggccgaggacgagatcgcgggaatcggtgcggcgctcggcgcttcg
ctcggcggctcgctcggtgtcaccagtacgtcgggaccgggcctggcgctcaagagcgaa
accatcggcctcgcggtgatgaccgagctgccgctgctggtcgtcgacgtgcagcgcggc
ggtccctccaccggcctgccgaccaagaccgagcaggcggatctgttgcaggcgctatac
ggccgcaacggcgaatcaccggtcgcggtcctcgcgccacgctcgcccgccgactgcttc
gccaccgcggtcgaggcggccaggatcgcgctcacctatcgcacgccggtgctgctgctg
tcggacgggtccatcgcgaatgggtctgagccatggtcgattccgaatgtcgccgacctg
ccgccgatcgtcccgggcttcgagcccgccggcgcggaaacggacccgttccagccctac
gcacgcgacccggagacactcgcccggccccttgccgtcccgggcaccaaggggcgcgcg
caccggatcggtggcctggagaaagccgacggcagcggcaacatctcctacgacccggcc
aatcacgaactgatggtgcggttgcggcaggccaagatcgacgggatcagcgtgcccgat
ctcgaggtcgacgatccggacggccacgccgaactgctgatcatcggctggggcagttcg
tacggaccgatcggcgaagcctgccggcgcgcccgccgccgcggtgtgcctgtcgcgcag
gcacacctgcggcatctgaatccgttgcccgccaacctcggtgacgtgctgcgccgctac
cgcaccgtggtcgcgccggagatgaacggcggccagctcgcgctgcttttgcgcgggaaa
tatctggtcgacgtgcggccgtggacgaaggtcgcgggcaccgcgttctccgcgcaggaa
ctcgtcggggtgatcgacgccgcgttggacggctcgatcgaggagatggaacacgacaag
gccttcgccgcacgggcgcgggccacgtacacgacgcagccggacagctccgcggatcgg
gcacagccgggcgacgtccgacctactgggggcaacgaatga

KEGG   Nocardia brasiliensis: O3I_028535Help
Entry
O3I_028535        CDS       T02270                                 

Definition
(GenBank) 2-oxoglutarate ferredoxin oxidoreductase subunit beta
  KO
K00175  2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00010  Glycolysis / Gluconeogenesis
nbr00020  Citrate cycle (TCA cycle)
nbr00620  Pyruvate metabolism
nbr00650  Butanoate metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Module
nbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_028535
   00020 Citrate cycle (TCA cycle)
    O3I_028535
   00620 Pyruvate metabolism
    O3I_028535
   00650 Butanoate metabolism
    O3I_028535
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     O3I_028535
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     O3I_028535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AFU03656
UniProt: K0F855
Position
6497122..6498192
Genome map
AA seq 356 aa AA seqDB search
METSLVGTDLGLTGLSGVPAADGPQKVKDFTSDQEVRWCPGCGDYVILATVRGFLAELGL
RRENLMFVSGIGCSSRFPYYLEAYGIHSIHGRAPAIATGLAVTRPDLSVWVVTGDGDALS
IGGNHLIHALRRNVNMTILLFNNRIYGLTKGQYSPTSEEGKITKSTPMGSVDHPFNTLSV
ALGAEATFAARALDSDRAGLTEVLRAAAEHRGTSFVEILQDCPIFNDGSFDALRRDNAAN
HLVPLHHGQPIRFGADNEFAVIQNGFGLEVTRADAVPESDIVIHDAYTDNPEYAYALSRL
SDQSLDHVVTGIFRSVSRPTYDDGVRAQTAAARERKPLDQNSLQSLLTGPETWTVS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggaaacctcgctcgtcggtaccgatctgggcctgacgggactgtccggtgtgcccgcc
gccgacggcccgcagaaggtcaaagacttcacctccgatcaggaggtgcgctggtgcccc
ggctgcggtgactacgtgatcctggcgaccgtgcgcggcttcctcgccgagctcggattg
cgcagggagaacctgatgttcgtgtccgggatcggctgctccagccgcttcccgtactac
ctcgaggcgtacggcatccactccatccacgggcgcgcgcccgccatcgcgaccggactc
gcggtgaccaggccagatctgtcggtgtgggtggtgaccggggatggcgacgcgctgtcc
atcggcggcaaccatctcatccacgcgttgcgccgcaacgtgaacatgacgatcctgctg
ttcaacaaccggatctacgggctcaccaaggggcagtactcgccgacctcagaggaaggc
aagatcaccaagtccaccccgatgggctcggtggaccacccgttcaacacgctgtccgtc
gcgctcggcgccgaggccaccttcgccgcccgtgccctcgactccgaccgggccgggctg
accgaggtgctacgcgccgccgccgaacatcgcggcacgtcgttcgtcgaaatcctgcag
gactgcccgattttcaacgacggctcgttcgacgcgctgcgccgcgacaacgccgcgaac
cacctggtcccgctgcaccacggacagcccatccggttcggcgccgacaacgaattcgcc
gtgatacaaaacggtttcgggctggaagtcacccgggccgacgcggtccccgagtccgac
atcgtcatccacgacgcctacaccgacaacccggaatacgcctacgccctctcccgcctg
tccgaccagtccctggaccacgtcgtcaccggcatcttccgcagcgtcagccgacccacc
tacgacgacggagtccgcgcgcaaaccgccgccgcgcgcgaacgcaaacccctggaccag
aactccctccagtccttgctgaccggccccgaaacctggaccgtcagctag

DBGET integrated database retrieval system