KEGG   Nocardia brasiliensis: O3I_029480Help
Entry
O3I_029480        CDS       T02270                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00010  Glycolysis / Gluconeogenesis
nbr00520  Amino sugar and nucleotide sugar metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Module
nbr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nbr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_029480
   00520 Amino sugar and nucleotide sugar metabolism
    O3I_029480
Enzymes [BR:nbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     O3I_029480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFU03845
UniProt: K0F3Y8
Position
6706842..6707600
Genome map
AA seq 252 aa AA seqDB search
MSARGHAFGIDIGGSGVKGGAVDLATGELVHERIKIATPQPSTPQAVADAVAKLVAQADW
DGPVGITLPSVVLDGVARTAANIDKAWVGTDARALFSTALDGRPVTVLNDADAAGLAEDR
YGAAKDFDGLVLLLTFGTGIGSALLYQGTLVANSELGHLEVGGMETEHRAAASIKDRDGL
SYEQWAAEVSTILIGLENLFWPKVFVAGGGISRDADLWIPLLTNRTQVIPAHLKNTAGIV
GAAMAIDAGIAP
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctcgggggcacgcattcggcatcgatatcggcggcagcggcgtcaaaggtggc
gcggtggatctggccaccggcgagctggtccacgaacggatcaagatcgcgacaccgcag
ccgtccaccccgcaggcggtcgccgacgcggtggcaaagctggtcgcgcaagccgattgg
gacggtccggtcggcatcacgctgccgtcggtggtgctcgacggcgtcgcccgcaccgcc
gccaacatcgacaaggcgtgggtgggcaccgacgcgcgcgcgttgttctcgaccgcgctg
gacggccgtcccgtcaccgtgctcaacgacgcggacgcggccggcctggccgaggaccgc
tacggcgcggcaaaggatttcgacgggctcgtgctgctgctgaccttcggcaccggcatc
ggctcggccctgctgtaccagggcacgctggtggccaacagcgaactcggccacctcgag
gtcggcggcatggagaccgaacatcgcgccgccgcgtcgatcaaggatcgcgacggtctc
agctacgaacagtgggccgccgaggtcagcaccatcctgatcggcctggaaaatctcttc
tggccgaaagtattcgtcgcgggcggcgggatcagccgcgatgccgacctgtggattccg
ttgctcaccaatcgaactcaggtcatccccgcgcatctgaagaacaccgcgggcatcgtc
ggcgcggcgatggccatcgatgccggtatcgcgccataa

DBGET integrated database retrieval system