KEGG   Nocardia brasiliensis: O3I_030940Help
Entry
O3I_030940        CDS       T02270                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase)
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00900  Terpenoid backbone biosynthesis
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01130  Biosynthesis of antibiotics
Module
nbr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    O3I_030940
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     O3I_030940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C Epimerase Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AFU04137
UniProt: K0F332
Position
complement(7020132..7021292)
Genome map
AA seq 386 aa AA seqDB search
MRHNERVSDIVKVLLLGSTGSIGTQALEVIAANPDRFEVVGLAARGGNTALLAQQMAATG
TRNVAVADPAAAAHLDLELAGPAAVTELVRRTEADVVLNALVGSLGLEPTLATLQSGTRL
ALANKESLVAGGSLVTRAAAPGQIVPVDSEHSALAQCLRGGRADEVDRLVLTASGGPFRG
WTTEMLESVNPAEAKTHPTWSMGPMNTLNSASLVNKGLELIETHLLFGIPYDRIDVTVHP
QSIVHSMVTFTDGSTLAQASPPDMKLPIALALGWPDRVPGAAASCDWGTAATWTFEPVDS
AVFPAIDLARRAGEAGGSVTAVYNAANEVAVQAFLDGKIRFPEIVRTVAAAVEAADQWRP
EPTSLAEVLAADTWARDFTRGRVDPA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccacaatgaacgggtgtccgacatcgtgaaagtcctgctcctcggcagcaccgga
tccattggtacccaagcgctcgaggtgatcgccgccaatcccgaccggttcgaggtggtc
ggcctggctgctcgcggcggtaatacggcgctgctggcgcagcagatggcggccaccggg
acgcgcaatgtcgcggtcgccgacccggccgccgccgcgcacttggacctggaactcgcc
ggtcccgcggcggtgaccgaactggtccgccgcaccgaggccgacgtcgtgctcaacgcg
ttggtcggttcgctcgggctcgagcccaccttggccaccctgcaatcggggaccaggctg
gcgctggccaacaaggagtcgttggtcgccggtggttcactcgtcacccgcgcggccgca
cccggccagatcgtgccggtcgattcggaacattccgcgctggcccagtgcctgcgcggc
gggcgtgccgacgaggtggaccgcctcgtgctcaccgcgtcgggcggtccgttccgcggc
tggaccaccgagatgctggaatcggtgaatccggctgaggccaagacacatccgacgtgg
tcgatgggcccgatgaacacgctcaattcggcctcgctggtgaacaagggcctcgagttg
atcgagacgcacctgctgttcggcattccgtacgaccgcatcgacgtcaccgtgcacccg
cagtcgatcgtgcattcgatggtcaccttcaccgacggttccacgctggcgcaggcgagc
ccgccggatatgaagctgccgatcgcgctggccctcggctggccggaccgggtgcccggc
gcggccgcctcctgtgattggggcaccgccgccacctggaccttcgagccggtcgacagc
gcggtcttcccggccatcgatctggcccggcgggccggcgaggcgggcggcagcgtcacc
gccgtgtacaacgccgccaacgaggtcgcggtgcaggcgtttctcgacggcaagatccgc
ttccccgagatcgtgcgcaccgtcgcggcggcggtcgaggccgccgaccagtggcggccc
gaacccacgtcgctcgccgaggtcctggccgccgacacgtgggctcgcgatttcacccgc
ggccgggtcgacccggcctag

DBGET integrated database retrieval system