KEGG   Nocardia brasiliensis: O3I_031205Help
Entry
O3I_031205        CDS       T02270                                 

Definition
(GenBank) putative acyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00010  Glycolysis / Gluconeogenesis
nbr00620  Pyruvate metabolism
nbr00640  Propanoate metabolism
nbr00680  Methane metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_031205
   00620 Pyruvate metabolism
    O3I_031205
   00640 Propanoate metabolism
    O3I_031205
  Energy metabolism
   00680 Methane metabolism
    O3I_031205
Enzymes [BR:nbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     O3I_031205
Lipid biosynthesis proteins [BR:nbr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   O3I_031205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFU04190
UniProt: K0F4Q2
Position
complement(7069575..7071203)
Genome map
AA seq 542 aa AA seqDB search
MGIDLNPRVRELLDMYDRPAASAADVLCDRHPANGIAFTIVESDLSSTDLTYGELRERSS
RFAAALADLGIGPGDRVATLMAKSADLVVALLAIWRRGAVHVPLFTAFAPPAIAFRLEAS
RTTVVIADADQAGKLAPGPDMPADAPWQVIVSGAAPSGSLSMSELLAGKSADDPNAAAVA
VGGDGLLIQLFTSGTTGTPKGVPIPLRALASFQAYQEFALDVRTDDVYWNAADPGWAYGL
YWAILSPLSSGIRSLLLHAGFSAPLTWQVLEHFGVTNFTAAPTVYRALRAAGGTPPRIRL
RRASSAGEPLTPEVVAWSLEHLGVAVRDHYGQTEHGMLICNAWHEALDAEVPAGSMGRTL
PGWTCAVLADDADTVAPVGELGRVAIDTANSPLLWFLGYLDAPERTAQRFTPDGRWYITG
DAGSQDENGCFRFSARDDDVIIMAGYRIGPFEVESVLVLHDQVAEAAVVGMPDELRGEVL
EAFVVLRNGSGGSDELAAELQELVKRKFAAHAYPRTVHFVPELPKTPSGKVQRFVLRQKG
NK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgacttgaatccacgtgtgcgggagttgctggacatgtacgaccggccggcg
gcctcggccgccgacgtactgtgcgaccggcatcccgcgaacgggatcgcgttcaccatc
gtcgagagcgacctgtcgtcgaccgatctcacctatggcgaactgcgggagcgctcgtcc
cggttcgccgcggcgctggccgacctcgggatcgggcccggcgatcgggtcgctacattg
atggcgaagtccgctgacctggtggtcgcgctgctggccatctggcgccgcggggcggtg
cacgtcccgctgttcaccgcgttcgcgccgcccgccatcgcgttccggctcgaggcgagc
cggaccacggtcgtcatcgccgacgcagaccaggcgggcaagctggcgccggggccggac
atgcccgcggacgcgccgtggcaggtcatcgtcagcggcgcggcgcccagcggctcgttg
agcatgtcggagctgctggccggcaaatccgcggacgatccgaacgccgccgcggtcgcg
gtcggcggagacggactgctgatccagctcttcaccagcggcaccaccggcacaccgaag
ggggtgccgattccgttgcgcgccttggcttccttccaggcgtaccaagagttcgcgctc
gacgtccgcacggacgacgtgtactggaacgccgccgatccgggctgggcctacggcctc
tactgggcgattctgtcgccgctgtccagcggtatccgcagcctgctgctgcacgcgggc
ttctccgcgccgctcacctggcaggtgctcgaacacttcggcgtcacgaatttcaccgcc
gccccgaccgtgtaccgcgcgctgcgcgcggcgggcggcacgccgccgcggatcaggttg
cgccgtgcgtcgtcggcgggtgagccgctcacgccggaggtcgtggcctggtcgctggag
cacctcggcgtcgcggtgcgcgatcactacggtcagaccgagcacgggatgctcatctgc
aacgcctggcacgaggcgctcgacgcggaggtgcccgcggggtcgatgggacgcacactg
ccgggctggacctgtgcggtgctggccgacgacgcggacactgtcgcgcccgtcggcgaa
ctgggccgtgtcgcgatcgacacggccaacagtccgctgctgtggttcctcggctatctg
gacgcgcccgaacgcaccgcgcagcgcttcacgccggacggccgctggtacatcaccggt
gacgcgggctcgcaggacgagaacggctgcttccgcttctccgcccgggacgacgacgtg
atcatcatggccgggtaccggatcggccccttcgaggtggaaagcgtgctggtgctgcac
gatcaggtcgccgaggccgccgtggtcggcatgcccgacgaactgcgcggcgaagtactg
gaggcgttcgtggtgttgcgcaacggttccgggggcagcgacgaactcgcggcggagttg
caggagctggtgaagcggaagttcgccgcgcacgcctatccgcgcaccgtgcatttcgtg
ccggagctgccgaagacgcccagcggcaaggtgcagcgattcgtcctgcggcagaaggga
aacaagtga

DBGET integrated database retrieval system