KEGG   Nocardia brasiliensis: O3I_033825Help
Entry
O3I_033825        CDS       T02270                                 

Definition
(GenBank) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00010  Glycolysis / Gluconeogenesis
nbr00030  Pentose phosphate pathway
nbr00052  Galactose metabolism
nbr00230  Purine metabolism
nbr00500  Starch and sucrose metabolism
nbr00520  Amino sugar and nucleotide sugar metabolism
nbr00521  Streptomycin biosynthesis
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
Module
nbr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_033825
   00030 Pentose phosphate pathway
    O3I_033825
   00052 Galactose metabolism
    O3I_033825
   00500 Starch and sucrose metabolism
    O3I_033825
   00520 Amino sugar and nucleotide sugar metabolism
    O3I_033825
  09104 Nucleotide metabolism
   00230 Purine metabolism
    O3I_033825
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    O3I_033825
Enzymes [BR:nbr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     O3I_033825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFU04714
UniProt: K0F530
Position
complement(7649233..7650873)
Genome map
AA seq 546 aa AA seqDB search
MAHDRAGRLARPTDLEDIAHLVTAYYSRIPDPSDPAQQVVFGTSGHRGSSLDTAFNEAHI
LAITQSIVEYRATRGITGPVYLARDTHALSEPALVTALEVLAANDVVAMIDARDRYTPTP
ALSHAVLRHNRGGTKHQADGIVITPSHNPPRDGGFKYNPPHGGPADNTATDAIAARANEL
LRSGLSGIKRTTLQHALETNVHRYDYLDHYIADLPNVLNLDAIRGAGIRLGADPMGGASV
DYWEEIGQRYDLELEVVNPFVDPTWRFMTLDSDGKIRMDPSSRYAMASLIAIKDDYDLST
GNDADADRHGIVTPDGGLMNPNHFLAVAIEYLVANRMGWDALTKIGKTVVTSSMIDRVVG
VLGRDVHEVPVGFKFFVPGLFSGSLAFGGEESAGASFLRMDGTVWTTDKDGILLALLAAE
IAAVTGQSPSARYVELEKRYGTPAYARIDAAATPEQKALLAKLTPDMITTKEIAGEPITS
VLTRAKGNGAPLGGLKVTTENAWFAARPSGTEDKYKIYAESFHGPEHLAQVQAAAEEVVG
QALSGE
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcccatgatcgagcagggcgactcgcgcgtcccaccgacctggaggacatcgcccac
ctggtcacggcctattacagtcgcatcccggatccgtccgatccggcgcagcaggtggtg
ttcggcacctccggccatcgtggctcgagcctggacaccgccttcaacgaggcgcatatc
ctggccatcacccagtcgatcgtggaataccgtgcgacgcgcgggatcaccggtccggtg
tatctggccagggacacgcacgcgctgtcggagcccgcgctggtcacggcgctcgaggtg
ctcgccgccaacgacgtggtggcgatgatcgacgccagggatcggtacacgccgacgccc
gcgctgagtcatgctgtgctgcgccacaatcggggcggcaccaaacatcaggccgacggc
atcgtgatcacgccgtcgcacaacccgccgcgcgacggcggcttcaaatacaacccgccg
cacggcggcccggccgacaacaccgccaccgacgccatcgccgcgcgggccaacgaactg
ctgcgcagcggcctgtccgggatcaagcggaccaccctgcagcacgcgctggagaccaac
gtccatcgctacgactacctcgaccactacatcgccgatctgccgaacgtgttgaacctg
gacgcgattcgcggcgcgggcatccggctcggcgccgacccgatgggcggggcgagcgtc
gactactgggaggaaatcgggcagcgctacgacctcgagctcgaggttgtcaacccgttc
gtcgaccccacttggcgtttcatgacgctggacagcgacggcaagatccggatggatccg
tcctcgcggtacgcgatggcctcgctcatcgcgatcaaggacgactacgacctgtccacc
ggcaacgacgccgacgccgaccggcacggcatcgtcacccccgacggcggtctgatgaac
ccgaatcacttcctcgcggtcgccatcgaatacctggtcgcgaaccggatgggctgggac
gcgctcaccaagatcggcaagacggtggtcacctcgtcgatgatcgaccgggtggtcggc
gtgctcggccgcgacgtgcacgaggtgcccgtcgggttcaagttcttcgtgcccggattg
ttcagcggcagcctcgctttcggcggtgaggagagcgcgggcgcctcgttcctgcggatg
gacggcaccgtctggaccaccgacaaggacggcatcctgctcgcgctgctcgccgccgag
atcgccgcggtcaccgggcagagcccgtcggcgcgctacgtcgaactcgaaaagcggtac
ggcactccggcctacgcgcggatcgacgccgccgcgaccccggaacagaaagcactgctg
gcgaagttgactccggacatgatcaccaccaaggagatcgccggtgagcccatcacgtcc
gtgctcaccagggcgaaaggaaacggcgcgccgctgggcggcctcaaggtgaccaccgag
aacgcctggttcgccgcccgcccgtcgggtaccgaggacaaatacaagatctacgcggag
tcgttccacggccccgagcatctggcgcaggtgcaggcggccgcggaggaagtggtggga
caggcgctatccggtgagtga

DBGET integrated database retrieval system