KEGG   Nocardia brasiliensis: O3I_034820Help
Entry
O3I_034820        CDS       T02270                                 

Definition
(GenBank) bifunctional uroporphyrinogen-III synthetase/response regulator domain protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00860  Porphyrin and chlorophyll metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
Module
nbr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    O3I_034820
Enzymes [BR:nbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     O3I_034820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AFU04911
UniProt: K0FBQ2
Position
complement(7859124..7860380)
Genome map
AA seq 418 aa AA seqDB search
MGGGGRATGGSTPDASACLAGFTIGITAARRADEFATLLVRRGAGVVFAPAIRIIPLADD
DELARVTRQLVVDPPQIVVATTGIGFRGWMEAAEGWGVAEQLRTTLASTRVLARGPKAKG
AIRAAELREEWSPASESSAEVLDHLLAEGVDGVRIAVQLHGATTEWEPVPDFCEVLRCAG
ADVVPVPVYRWEPPPDQQPMDQLIEAIVTSSLDCVTFTSAPAVASMLMRAKETGLLDGLL
HALRGRVLAACVGPITAAPLEELGVPTSMPGRARLGALARHVAEELPRRANRIYAAGHTL
SVRGGCVVVDGEVRQLAPAPMALMRSLARQPGRVVSREHLLAALPGGGDDTHAVETAIAR
LRAGLGAPKAIQTVVKRGYRLAMDAAECVDNNPRPELGGPQMPGFGTPLRHAQTMGAW
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggggggcggtggccgggcgacgggcgggtcaactcccgatgcaagcgcctgtctcgcg
ggattcaccatcggcatcacggcggcgcgacgcgccgacgagttcgccaccctgctggtc
cgccggggcgccggcgtggtgttcgcccccgccattcgcatcattccgctcgccgacgac
gacgaactggcgcgggtgacccgccagctggtcgtggatcccccgcagatcgtggtggcc
accaccggcatcggcttccgcggctggatggaggcggccgagggctggggtgtcgcggag
caactgcggaccaccctcgcgtccacccgggtgctggcgcgcggcccgaaggccaagggc
gccatccgcgcggccgaactgcgcgaggagtggtcgcccgcgtccgagtcctcggccgag
gtgctcgatcatctgctcgccgagggtgtggacggggtgcggatcgcggtgcagctgcac
ggcgcgaccaccgagtgggagccggtgcccgacttctgcgaggtattgcgttgcgccggt
gcggatgtcgtgccggtgccggtgtatcgctgggagccgccgccggatcagcagccgatg
gaccagctgatcgaggccatcgtcacctccagcctggactgcgtcacgttcaccagtgcg
cccgccgtcgcgtcgatgttgatgcgcgccaaggaaaccggactgctcgacgggctgttg
cacgcgctgcgcggccgggtgctggccgcatgcgtcgggccgatcaccgcggcgccgctg
gaggaactcggcgtgccgacctccatgccggggcgggcccgcctcggtgcgctggcccgg
cacgtcgccgaggaactgccgcgccgggccaatcggatctacgccgcgggccacacgctg
agcgtgcgcggcggctgcgtggtggtcgacggcgaggtgcgccagctggcgcccgcgccg
atggcgctgatgcggtcgctggccaggcagcccggccgggtggtttcccgggagcacctg
ctcgccgcgctgcccggcggcggggacgacacgcacgcggtggaaaccgcgatcgcccgg
ctgcgcgccggactcggtgcgccgaaggcgatccagaccgtggtcaagcgcggctaccgg
ctggccatggacgcggccgaatgcgtcgacaacaacccgcggcccgaactcggcgggccg
cagatgcccggtttcggtacaccgctgcggcacgcccagaccatgggggcgtggtga

DBGET integrated database retrieval system