KEGG   Nocardia brasiliensis: O3I_034890Help
Entry
O3I_034890        CDS       T02270                                 

Definition
(GenBank) putative hydrolase
  KO
K03821  polyhydroxyalkanoate synthase subunit PhaC [EC:2.3.1.-]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00650  Butanoate metabolism
nbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    O3I_034890
Enzymes [BR:nbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     O3I_034890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Abhydrolase_4 PGAP1 Lipase_3
Motif
Other DBs
NCBI-ProteinID: AFU04925
UniProt: K0F6D9
Position
complement(7874601..7875668)
Genome map
AA seq 355 aa AA seqDB search
MNIADTVTIAARNAWALTFGSGVEAPDPTPSTVLWDEPHRQLRRFEHRPGAPENTSTATD
SAVLLVPPLAAPATCFDLRPDQSLAGFLLETGRAPYVIDYGEITFADRRMGFEDWIDEIL
PEAVLRTSADRGGVPVDLVGWSLGGTLALLTAAAHAELPIRSITAVGSPLDYDKMTGIPQ
LRAVARFTGGIGTSTLVRAAGGVPASLTRIAYKVTAWDRELTRPWFVASNIARTETLARM
ETIDRFMAEMPGYPGRFYGQLWGRLILNNDIGRGVVRLGARRIELAQVSAPVLLVGGPSD
VITAAAAVEAGARNLTGAASVRYETSPGSHLGILTGPEARGTTWTYLDKFLVESA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatcgcggacaccgtcaccatcgccgcgcgcaacgcgtgggcgctgaccttcggt
tcgggcgtcgaggcgcccgatcccaccccgtcgacggtgctgtgggacgagccgcatcgc
cagctgcgccggttcgagcaccgccccggtgcgcccgaaaacacttcgaccgcaacggat
tcggccgtcctgctggtgccgccgctggccgcgccggccacctgcttcgacctgcgcccc
gaccagagcctggccgggttcctgctggagacgggccgggcgccctacgtcatcgactac
ggcgagatcaccttcgccgaccggcggatgggcttcgaggactggatcgacgagatcctg
cccgaggcggtgctgcgcacctccgccgatcgcggcggcgtgccggtcgacctggtcggc
tggtcgctcggcggcacgctggcgctgctcaccgccgccgcgcacgccgagttgccgatc
cggtcgatcaccgcggtcggctcgccgctggactacgacaagatgaccggtattccgcag
ctgcgcgcggtcgcccggttcaccggcgggatcggcacctcgacgctggtccgcgcggcc
ggtggcgtgcccgcctcgctgaccaggatcgcctacaaggtcaccgcgtgggatcgcgag
ctgacccgcccgtggttcgtcgcgagcaatatcgcgcgcaccgagacgctggcgcggatg
gagaccatcgaccgcttcatggccgagatgcccggctaccccggccgcttctacggccag
ctgtggggccggctgatcctgaacaacgatatcggccgcggcgtggtccggctcggcgcg
cggcgcatcgagctggcgcaggtgagcgcgccggtgctgctggtcggcgggccgagcgac
gtgatcaccgccgcggccgcggtcgaggcgggtgcgcgcaacctcaccggcgccgcctcg
gtccgctacgagacctcgcccggtagccacctgggcatcctcaccggccccgaggcgcgc
ggcaccacctggacctatttggacaagttcctggtcgaatcggcctga

DBGET integrated database retrieval system