KEGG   Nocardia brasiliensis: O3I_037720Help
Entry
O3I_037720        CDS       T02270                                 

Gene name
pgi
Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00010  Glycolysis / Gluconeogenesis
nbr00030  Pentose phosphate pathway
nbr00500  Starch and sucrose metabolism
nbr00520  Amino sugar and nucleotide sugar metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
Module
nbr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nbr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3I_037720 (pgi)
   00030 Pentose phosphate pathway
    O3I_037720 (pgi)
   00500 Starch and sucrose metabolism
    O3I_037720 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    O3I_037720 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nbr04147]
    O3I_037720 (pgi)
Enzymes [BR:nbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     O3I_037720 (pgi)
Exosome [BR:nbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   O3I_037720 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   O3I_037720 (pgi)
  Exosomal proteins of colorectal cancer cells
   O3I_037720 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: AFU05491
UniProt: K0FD03
Position
8455736..8457373
Genome map
AA seq 545 aa AA seqDB search
MSSDITATAAWRKLQEHFDAIAGQHLREIFADDPARGSELTVDVADLHIDYSKHRVTRET
LHLLVELAREAEVAEHRDAMFAGAHINTSEDRAVAHVALRVPAGESVVVDGADAGAEVHE
VLRRMGEFTDAVRAGEWRGATGARIETVVNIGIGGSDLGPVMVYQALRHYADAGVAARFV
SNVDPADLVAKLAGLDPATTLFIVASKTFSTLETLTNATAARRWLVAALGEDAVAKHFVA
VSTNAERVAEFGIDTANMFGFWDWVGGRYSVDSAIGLAVMAAIGKERFAEFLAGMHAVDE
HFAHAPLDANAPVLLGLLGVWYSNFFGAQSHAVLPYSNDLARFPAYLQQLTMESNGKSVR
ADGTPVSTATGEIFWGEPGTNGQHAFYQLLHQGTRLVPADFIGFARPTDDLPTRDGTGSM
HDILMSNLFAQTKVLAFGKTAEEIAAAGTDPKVVPHKVMPGNRPSTTILAAQLTPSVVGQ
LIALYEHQVFVAGAIWGIDSFDQWGVELGKQQALELAPLLSSPEEPAPQGDSSTDALIRW
YRDQK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcgacatcaccgcgacggcggcctggcggaaactgcaagagcatttcgacgcg
atcgcggggcagcacctgcgggagatcttcgccgacgacccggcccgcggcagcgagctg
acggtcgacgtggcagacctgcacatcgactacagcaagcaccgcgtcacgcgggaaacc
ttgcacctgctggtcgaattggcgcgcgaggcggaggtggccgagcatcgggacgcgatg
ttcgcgggcgcgcacatcaacacctccgaggatcgcgcggtcgctcacgtcgccctgcgg
gtgccggcgggcgagtccgtcgtcgtcgacggcgcagacgccggcgccgaggtgcacgag
gtgctgcggcggatgggcgaattcaccgacgcggtacgggcgggcgagtggcgcggcgcc
accggtgcgcgcatcgagaccgtggtcaatatcggcatcggcgggtcggatctcgggccg
gtgatggtgtatcaggcgctgcggcattacgccgacgccggtgtcgcggcccggttcgtc
tccaatgtcgacccggccgacctggtggcgaagctggccggactcgaccccgccaccacg
ctgttcatcgtcgcgtccaagaccttctccacgctggaaaccttgaccaacgccaccgcg
gcccgccgctggctggtggcggccctgggcgaggacgcggtcgccaagcacttcgtcgcg
gtttcgaccaatgccgaacgggtggccgagttcggcatcgacaccgccaacatgttcggt
ttctgggactgggtcggcggacgctactcggtggattccgcgatcgggctcgccgtgatg
gcggccatcggcaaggagcgtttcgccgagttcctggcgggcatgcacgccgtggacgag
cacttcgcacacgcgccgctcgacgcgaacgcgccggtgctgctcggcctgctcggcgtc
tggtactcgaacttcttcggcgcgcaatcgcatgcggtgctgccctattcgaacgatctc
gcacgcttcccggcgtacctgcagcagctcacgatggagtcgaacggcaagtcggtgcga
gccgacggtacgccggtcagtaccgccaccggcgaaatcttctggggcgagccgggaacc
aacggacagcacgcgttctatcaactgctgcaccagggcacgcgtctggtaccggcggat
ttcatcggattcgcccgtcccaccgacgatctgcccacccgggacggcaccggcagcatg
cacgacatcttgatgagcaacctgttcgcgcagaccaaggtgctcgcgttcggcaagacc
gccgaggagatcgcggccgcgggcaccgacccgaaagtggtgccgcacaaggtgatgcct
ggcaaccggccgagcaccaccatcctcgccgcgcagctgacgccgtcggtggtcggccag
ttgatcgcgctgtacgagcatcaggtgttcgtggcgggcgccatctggggcatcgacagc
ttcgaccagtggggcgtcgagctcggcaagcagcaggcgctcgagctggcgcccctgctc
agctcaccggaagagcccgcaccgcaaggagattcgtcgaccgacgcactcatccggtgg
taccgcgaccagaaatag

DBGET integrated database retrieval system