KEGG   Candidatus Nitrosopelagicus brevis: T478_1249Help
Entry
T478_1249         CDS       T03537                                 

Definition
(GenBank) putative acetyl coenzyme A synthetase (ADP forming), alpha domain protein
  KO
K18593  4-hydroxybutyrate---CoA ligase (ADP-forming) [EC:6.2.1.56]
Organism
nbv  Candidatus Nitrosopelagicus brevis
Pathway
nbv00720  Carbon fixation pathways in prokaryotes
nbv01100  Metabolic pathways
nbv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nbv00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    T478_1249
Enzymes [BR:nbv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.56  4-hydroxybutyrate---CoA ligase (ADP-forming)
     T478_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 ATP-grasp_2 CoA_binding Dak1_2 DUF2540
Motif
Other DBs
NCBI-ProteinID: AJA92720
UniProt: A0A0A7V7S5
Position
complement(1021209..1023305)
Genome map
AA seq 698 aa AA seqDB search
MTNSVFLSPKSIAIIGASDKEGSVGRAITNNIMKGYKGTIYPISPTRETVFDKKAYKSVL
DVPGKVDLAVVVTKNTIVPAVLEECGKKKLRGAIVITAGFKEVDEEGAKLEQKLKDIAKK
YKLQIIGPNCLGVMNLEPQTMMNSTFLKITPKSGEIALVSQSGAICAALVEDASAQGIGF
SAVISMGNKADMSEIDILKMLAEHKQTKVIVIYLEDMGNGQEFLKVCKDITRKKKKPVLV
LKSGRSPEGAKAAMSHTGALMGSDEIYDALLKQSGAIRVDTMEELFDYATAFSKQPLPMN
GDLVIVSNAGGPAIISTDACSKLGIKMAKIEEIRKKIDAVIPPWGSSRNPVDIVGDADFK
RFENVLNEVLKHKNVGSVISMCTPSATLNYDKLAEVIVSMSKKYKKTMLASLMGLDEGIT
NREILAKGDVPYYTYAEGSIRALKAMLTFTDWVKNSPGKITKFNVKKNTVKKILDNAKKQ
KRSALLEEEGQEILRAYGFPLPASKLAKSKKEAVAASKKIGYPVVLKIASPQIIHKSDAG
GVKVNLQNAKDVENAFDTIIKNAKKYNKKADIKGVLVVEMVKGGKEMIIGSKLEPGFGPV
VMLGMGGIYVEVLKDVTFRLAPMTNIEADDMISSIKTKKILEGVRGEKPSDIKKLSECIQ
RLSQLVSDFNEIKELDMNPVLVMEKNKGCKVLDVRIGL
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattctgttttcctttctccgaaatctattgcaattattggtgcttctgataaa
gaaggtagtgtaggtcgtgcaattactaataacattatgaaaggttacaaaggaacaatt
tatccaattagcccaacacgtgaaactgttttcgacaaaaaagcatacaaatcagtttta
gatgttcccggaaaagttgacttggcagttgttgtcacaaaaaatactattgttccagca
gtgttagaagaatgtggaaaaaagaaactaagaggtgcaattgtaattactgcaggattc
aaagaagtagatgaagaaggtgcaaaattagaacaaaaattaaaagatattgcaaaaaaa
tacaaattacaaattattggtccaaactgtcttggtgtgatgaatcttgaaccacaaacc
atgatgaattctacatttctcaaaattactcccaaatctggagaaattgctcttgtttca
caaagtggtgcaatatgcgctgcattagttgaagatgcaagtgcacaaggaattggattt
tccgcagtaattagtatgggaaataaagccgacatgagtgaaattgatattttaaagatg
cttgctgaacataaacaaaccaaggttattgttatctatcttgaagatatgggcaacggt
caagaatttcttaaagtgtgtaaagacattacaagaaaaaagaaaaaacctgttttggta
ttgaaatcaggacgaagtccagaaggagcaaaagctgcaatgtcacataccggagcttta
atgggttctgatgaaatttacgatgcattactaaaacaatcaggtgcaatacgtgttgat
acaatggaagaattatttgattatgcaactgcattttcaaaacaaccacttccaatgaac
ggcgatttagtaatcgtttcaaacgccggtggtcctgctataatttcaactgatgcatgt
tcaaaacttggaattaaaatggcaaaaattgaagaaattagaaaaaaaattgatgctgta
attcctccatggggaagttcacgtaatccagtagacattgtaggagatgcagatttcaaa
agatttgaaaatgttttgaatgaagtgttaaaacacaaaaatgttggatctgtaatttct
atgtgtacaccatctgctactttgaattacgataagcttgcagaagtcatagtttctatg
tcaaaaaaatataagaaaacaatgttagccagtttgatgggactagatgaaggaataact
aatcgtgaaattttggcaaaaggtgatgttccatactacacttatgcagaaggttcaatt
cgtgcactaaaagccatgcttacattcacagactgggtaaaaaattctcctggaaaaatt
acgaaatttaatgtgaaaaaaaataccgtaaaaaagattttagataatgcaaaaaaacaa
aaacgaagtgctcttttagaagaagaaggccaagaaattctcagagcgtatggttttcca
ttacctgcaagtaaattagcaaaatcaaaaaaagaagcagtcgctgcttctaaaaaaatc
ggttatccagttgtattaaaaattgcatcacctcaaatcatccataaatctgatgctggt
ggagtgaaagttaatttgcaaaatgcaaaagatgttgaaaatgcatttgatactataata
aaaaatgcaaaaaaatacaacaagaaagccgatatcaaaggtgttttggttgttgagatg
gtaaaaggtggaaaagaaatgattattggttcaaaattagagccagggtttggacctgtt
gtaatgctcggaatgggaggaatctatgttgaagtcttaaaagatgttactttcagactt
gcaccgatgacaaacattgaagcagatgatatgatttcatcaattaaaactaaaaaaatt
ctagaaggtgttagaggtgaaaaaccatctgatatcaaaaaactctctgaatgcattcag
agactatctcagctagtatctgatttcaatgaaattaaagaattagatatgaatcctgtt
ctggttatggaaaaaaataagggttgtaaagttctagatgtgcgtattggtttatag

DBGET integrated database retrieval system