KEGG   Candidatus Nitrosopelagicus brevis: T478_1287Help
Entry
T478_1287         CDS       T03537                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
nbv  Candidatus Nitrosopelagicus brevis
Pathway
nbv00900  Terpenoid backbone biosynthesis
nbv01110  Biosynthesis of secondary metabolites
nbv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nbv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    T478_1287
Enzymes [BR:nbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     T478_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AJA92643
UniProt: A0A0A7V1D2
Position
1058581..1059741
Genome map
AA seq 386 aa AA seqDB search
MADSSIPKFFEKTHEEKLDIICNFSDLNDDELNHLKNATGGLDFEYANKMIENAIGTFSL
PLGIATNFKINNVDYLVPMVIEEPSVIAAASKAAKIAKLHGGFTAKVDGNISIGQIQVLD
VDIQESISTINSNSDQIIELANSSSKTLPKLGKGAKEVKCKEIKTPSSSMLIVELMIDVG
DAMGANVTNTMCETVAPLIEKLTGGKTLLRILSNYSTKRMVTATATFDKDAVGGEQVVND
MISAFDFADNDVYRAVTHNKGVMNGAISVANATGQDSRAIEAAAHAYASHTGRYRSLTQW
SKDNDGHLVGKFEIPLSVGIVGGVTNNHPIAKLCTKILNLKNVQELSCIIASTGLAQNFA
AMRALATEGIQKGHMKLHARKEASNS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggctgattcatcgattccaaaattttttgagaaaactcatgaggagaaattggatatt
atttgtaatttctcagatcttaatgatgatgaattaaatcatctcaaaaatgcaactggt
ggattggattttgaatatgcaaacaaaatgattgaaaatgcaattggtacattttcgctt
cctcttgggattgctactaattttaaaattaacaatgtggattatcttgttcctatggta
attgaagaaccatcagtaattgctgctgcatcaaaggctgcaaaaattgctaaacttcat
ggtggttttactgcaaaagttgatggaaatatcagtattggacaaatccaagttttagat
gtagatattcaagaatcaatttctactataaattcaaattctgatcagataattgaacta
gcaaattcttcaagtaaaacattaccaaaattaggtaagggtgcaaaagaagtaaaatgt
aaagaaatcaaaactccctcatcatctatgttaattgtagaattgatgattgatgtaggt
gatgctatgggtgcaaatgtaactaatactatgtgtgaaactgttgcaccattaattgaa
aaattaacaggtggaaaaacattattgagaatactttcaaattattctaccaaacgaatg
gtaacagcaactgcaacatttgataaagatgcagttggtggagaacaagtcgttaatgac
atgatctctgcatttgattttgctgataatgatgtttatcgtgcagttactcataacaaa
ggtgtcatgaacggtgcaatttctgttgcaaatgctacaggacaagacagtcgtgcaatt
gaagcagctgcacatgcatatgcatctcacactggacgatatcgctcgttaacgcaatgg
tcaaaagataatgacggacatcttgttggaaaatttgaaattcctctttcagttggaatt
gttggaggagttactaataatcacccaattgcaaaactttgtactaaaatacttaatcta
aaaaatgtccaagaattatcatgtattattgcttcaaccggattggcacaaaattttgct
gctatgcgtgccttagcaacagaaggaattcagaaaggtcacatgaaattacacgctcga
aaagaggcaagtaattcctaa

DBGET integrated database retrieval system