KEGG   Nocardioides sp. JS614: Noca_0026Help
Entry
Noca_0026         CDS       T00443                                 

Definition
(GenBank) protein phosphatase 2C domain protein
  KO
K20074  PPM family protein phosphatase [EC:3.1.3.16]
Organism
nca  Nocardioides sp. JS614
Brite
KEGG Orthology (KO) [BR:nca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:nca01009]
    Noca_0026
Enzymes [BR:nca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Noca_0026
Protein phosphatases and associated proteins [BR:nca01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    Noca_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP2C PP2C_2 SpoIIE
Motif
Other DBs
NCBI-ProteinID: ABL79576
UniProt: A1SCP1
Position
complement(29771..31087)
Genome map
AA seq 438 aa AA seqDB search
MTDTPAAAPSLRLRFAAISDVGRVRKDNQDSGYVGPWLVAVCDGVGGAARGDIASSTAIA
QLRRLDVSPSGESADDLLTKVAGALHRAHERINELAAEDPALDGTSTTATVALFDGARVA
MGHVGDSRAYLFRDGEITRLTSDHTFVQTLIDEGRITEAEARVHPHRNLILNALGGPGDV
EPDLFMIELAPKDRLLLCSDGASGVLDDDRLADILATGSPEFASVELVRASLEAGSSDNV
TCLVADAVDAAEPPGPGEAEEPVLVGAAAERRLHRQRGGMGSLFRGHRSGDTGELEPVQA
EILDLPYAITADPIDPEEARYAPRPPRRFVWLKRLLTLVLLVGLAWVGIAAAWSWTQGQY
YVGEQDGTVVIFRGVNTELAGLSLSEPYESSDVELDRLGEVEADRVREGIAYDNLEDAEQ
KVRDLAARQSPASESSAG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacgccagcagcggcgccgagcctgcgcctgcggttcgccgcgatctccgac
gtcgggcgggtccgcaaggacaaccaggactccgggtacgtcggcccgtggctggtcgcg
gtctgcgacggcgtcggcggcgcggcccgcggtgacatcgcctccagcaccgcgatcgcc
cagctgcggcggctcgacgtgtccccgagcggcgagtccgccgacgacctgctcaccaag
gtcgccggcgccctgcaccgggcccacgagcggatcaacgagctcgccgccgaggacccc
gcactcgacggcaccagcaccaccgcgacggtcgcgctcttcgacggcgcgcgggtcgcg
atgggccacgtcggcgacagccgggcctacctgttccgcgacggcgagatcacccggctc
acctccgaccacaccttcgtgcagaccctgatcgacgagggccggatcaccgaggccgag
gcccgggtccacccgcaccgcaacctgatcctcaacgccctgggtggtcccggcgacgtc
gagcccgacctcttcatgatcgagctggcgccgaaggaccggctgctgctgtgcagcgac
ggcgccagcggggtcctcgacgacgaccggctggccgacatcctcgccaccgggagcccg
gagttcgcctcggtcgagctggtccgcgccagcctcgaggccggcagctccgacaacgtc
acctgcctggtcgccgacgccgtcgacgccgccgagccgcccggccccggcgaggcggag
gagccggtgctggtcggcgcggccgccgagcggcgcctgcaccgccagcgcggcggcatg
ggcagcctgttccgcggccaccggtcgggcgacaccggcgagctcgagccggtgcaggcc
gagatcctcgacctgccctacgcgatcaccgccgacccgatcgacccggaggaggcgcgc
tacgcgccgcgcccgccgcgccgcttcgtgtggctcaagcggctgctgacgctcgtgctc
ctggtcggcctcgcctgggtcggcatcgccgccgcctggtcgtggacccaggggcagtac
tacgtcggcgagcaggacggcacggtcgtcatcttccgcggcgtcaacaccgagctggcc
ggcctctcgctctccgagccctatgagagctcggacgtcgagctggaccggctcggcgag
gtcgaggccgaccgggtccgcgagggcatcgcctacgacaatctcgaggacgccgagcag
aaggtccgcgacctcgccgcccggcagtcccccgcctccgagagctcggccggctga

DBGET integrated database retrieval system