KEGG   Nocardioides sp. JS614: Noca_0116Help
Entry
Noca_0116         CDS       T00443                                 

Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00010  Glycolysis / Gluconeogenesis
nca00520  Amino sugar and nucleotide sugar metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01120  Microbial metabolism in diverse environments
nca01130  Biosynthesis of antibiotics
nca01200  Carbon metabolism
Module
nca_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noca_0116
   00520 Amino sugar and nucleotide sugar metabolism
    Noca_0116
Enzymes [BR:nca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Noca_0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABL79661
UniProt: A1SCX6
Position
complement(129996..130754)
Genome map
AA seq 252 aa AA seqDB search
MAQTAPQPFGIDFGGTGIKGAPVDLEAGDFAAERVRIRTPDPSTPERVAAVFVELLRRFP
DSTGAVGVTVPGVVRHGVVRSAANIDRAWVGTDADRLFTRATGREVHVVNDADGAGLAEV
RYGAAKGRSGLVIVTTLGTGIGSAMVYDGVLVPNSELGHLEVEGHDAESRAANSARERED
LSWEQWAKRLTTYYRTLERLFSPELFVVGGGVSKSSAEFLALVDIDTEIIPAALLNKAGV
VGAALYASEGGG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcccagacggcaccgcagcccttcggcatcgacttcggtggcaccggcatcaagggc
gcaccggtcgacctcgaggccggcgacttcgccgccgagcgggtccggatccggaccccc
gacccgtccacacccgagcgggtggcggcggtcttcgtcgagctgctgcgccgattcccg
gactccaccggcgcggtcggcgtgacggtccccggggtggtccgccacggcgtggtccgc
tcggcggccaacatcgacagggcctgggtcggcaccgacgccgaccggctcttcacccgg
gccaccggccgcgaggtgcacgtcgtgaacgacgcggacggcgccgggctggccgaggtg
cggtacggcgcggcgaagggccgctccggcctggtgatcgtgaccaccctcggcaccggg
atcggctcggcgatggtctacgacggcgtcctggtgccgaactccgagctcggccacctc
gaggtcgagggccacgacgccgagtcccgggcggccaacagcgcccgcgagcgcgaggac
ctgtcctgggagcagtgggcgaagcggctcacgacgtactaccgcaccctggagcggctc
ttctctcccgagctgttcgtggtcggcggcggggtcagcaagtcctccgccgagttcctc
gcgctggtggacatcgacaccgagatcatcccggcggcgctgctcaacaaggccggggtg
gtgggcgcggcgctctacgcctccgagggtggcggctga

DBGET integrated database retrieval system