KEGG   Nocardioides sp. JS614: Noca_0354Help
Entry
Noca_0354         CDS       T00443                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00860  Porphyrin and chlorophyll metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01120  Microbial metabolism in diverse environments
Module
nca_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Noca_0354
Enzymes [BR:nca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Noca_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C PrpF
Motif
Other DBs
NCBI-ProteinID: ABL79898
UniProt: A1SDL3
Position
379670..380788
Genome map
AA seq 372 aa AA seqDB search
MTDSLPLAGFRIGVTAARKVDEQVTLLERRGATVEWAPALSLDPNRVDDAALRAATEEVL
AAPVDMILATTGIGMRTWFDAAERWGLLPRLLRALGSAEILARGPKSVGALRARGLRELW
APESECFEDVLEHLRGRSLAGLRIVVQEHGQSLSMVAHALRRQGAEVTTVTVYRVVSAED
PGPMFALVDLVADRSLDAVTFTSAPAVAALMDAAGSTGRRDELVSAFQADVVAACVGPVT
AAAFEMWGVPTIFPERSRLGAMVKQLETELPVRRSGLAIGLVGGHRLLLHGEDVLLDGAE
VRLSPAPAAVLQALVANPGNVVPRRALLAMLPSGTAGSEHAVEMAVARLRAALGTRTVQT
VVKRGYRLAVAS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacagcctccccctcgccggcttccggatcggcgtgaccgccgcccggaaggtc
gacgagcaggtcaccctgctcgagcgccgcggtgcgacggtggagtgggccccggcgctg
tcgctggacccgaaccgggtcgacgacgcggcgctgcgggcggccacggaggaggtgctc
gccgcgccggtggacatgatcctggcgaccacaggcatcgggatgcggacctggttcgac
gcggcggagcgctgggggctgctgccccggctgctgcgtgccctgggctccgcggagatc
ctggcccgcgggccgaagagcgtcggcgcgctgcgggcccgcgggctgcgcgagctgtgg
gcgccggagtcggagtgcttcgaggatgtgctcgagcacctgcgtggtcgctcgctcgcg
ggcctgcggatcgtcgtgcaggagcacggccagtcgctgtcgatggtcgcgcacgcgctg
cgccggcagggcgccgaggtcaccacggtcaccgtctaccgggtggtgtccgccgaggac
ccggggccgatgttcgcgctggtcgacctggtcgccgaccgttcgctggacgcggtcacg
ttcacctctgcgccggccgtcgcggccctgatggacgccgcaggctcgaccggtcggcgc
gacgagctggtctcggcgttccaggcggacgtggtcgccgcctgcgtggggccggtgacc
gcggcggccttcgagatgtggggggtgccgacgatcttcccggagcgctcgcggctcggc
gcgatggtcaagcagctggagaccgagctgcccgtgcggcgctcggggctggcgatcgga
ctcgtcggcggccaccggctgctgctgcacggcgaggacgtgctgctcgacggtgccgag
gtgcgcctctcccccgcccctgccgcggtcctccaggcactggtcgccaaccccggcaac
gtggtcccccgccgggcgctgctggcgatgctgccctccggcacggccgggtccgagcac
gccgtcgagatggcggtcgcccggctgcgcgcggccctcggcactcgcaccgtccagacc
gtcgtcaagcgcggctaccggctggccgtcgcctcctga

DBGET integrated database retrieval system