KEGG   Nocardioides sp. JS614: Noca_0981Help
Entry
Noca_0981         CDS       T00443                                 

Definition
(GenBank) LmbE family protein
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
nca  Nocardioides sp. JS614
Brite
KEGG Orthology (KO) [BR:nca00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Noca_0981
Enzymes [BR:nca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     Noca_0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: ABL80503
UniProt: A1SFB8
Position
1030444..1031373
Genome map
AA seq 309 aa AA seqDB search
MTQHPTHHQAHRPARPPDGPRAGLRLMHVHAHPDDESSKGAATTARYVAEGVDVHVATCT
GGERGSILNPKMDRPDILANITEIRRQEMERARDILGIRQDWLGFVDSGWPEGDPKPPLP
DGCFALVPLEEAIAPLVRLVREFRPHVMTTYDERGGYPHPDHVKCHQVSVAAFEAAADPE
RFPELGEPWQVLKLYYHHSFNRPRMVAIDEAMREHGLESPYAERLKDWKPEPEWDARITT
RVPCADYFGVRDQALLAHATQIDPDGFWFAIPRELQERVWPTEDYELVVSHVPAPPPEDD
LFAGITDQR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcagcaccccacccaccaccaggctcaccgcccggcacgaccgcccgacggcccc
cgcgccggcctccgcctgatgcacgtccacgcccaccccgacgacgagtcgtccaagggc
gccgcgacgacggcgcgctacgtcgcggagggggtcgacgtccacgtcgcgacgtgcacc
ggcggtgagcgcggctcgatcctgaacccgaagatggaccggcccgacatcctggcgaac
atcaccgagatccgccgccaggagatggaacgggcccgtgacatcctcgggatccggcag
gactggctgggcttcgtcgactccggctggcccgagggggacccgaagccgccgctgccg
gacggctgcttcgcgctggtgccgctggaggaggcgatcgcaccgctggtgcgcctggtg
cgggagttccgcccgcacgtgatgacgacgtacgacgagcgcgggggctacccgcacccc
gaccacgtgaagtgccaccaggtcagcgtcgcggcgttcgaggccgccgccgacccggag
cggttccccgagctgggcgagccctggcaggtcctcaagctctactaccaccactccttc
aaccggccccggatggtggcgatcgacgaggcgatgcgtgagcacggcctggagtcgccg
tacgccgagcgcctcaaggactggaagccggagccggagtgggatgcccggatcaccacc
cgggtgccgtgtgcggactacttcggggtgcgcgaccaggcgctgctcgcgcacgccacc
cagatcgacccggacgggttctggttcgccatcccgcgcgagctgcaggagcgggtctgg
ccgaccgaggactacgagctggtcgtgagccacgtgcccgccccgccccccgaggacgac
ctgttcgccggcatcaccgaccagcgctga

DBGET integrated database retrieval system