KEGG   Nocardioides sp. JS614: Noca_1386Help
Entry
Noca_1386         CDS       T00443                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00450  Selenocompound metabolism
nca00970  Aminoacyl-tRNA biosynthesis
nca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Noca_1386
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Noca_1386
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nca01007]
    Noca_1386
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nca03016]
    Noca_1386
Enzymes [BR:nca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Noca_1386
Amino acid related enzymes [BR:nca01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Noca_1386
Transfer RNA biogenesis [BR:nca03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Noca_1386
 Prokaryotic type
   Other AARSs
    Noca_1386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ABL80900
UniProt: A1SGG5
Position
1462407..1464194
Genome map
AA seq 595 aa AA seqDB search
MSRVLSAVAWPYANGPRHIGHVAGFGVPSDVFSRYMRMAGHDVLMVSGSDEHGTPILIAA
DEAGLSPQELADRNHRIIAEDLASLGLTYDLYTRTTTRNHHAVVQELFLGVYENGYFVEQ
TTYGAISPSTGRTLPDRYIEGTCPICGYDGARGDQCDNCGNQLDPHDLIDPRSKINGETP
EFIETQHFFLDLPALAEALGEWLDGREATGLWRPNVIRFSQNILKEIRPRAMTRDIDWGI
AVPLDGWRENPTKRLYVWFDAVIGYLSASIEWARRLDEPDRWRDWWNDPDALSYYFMGKD
NITFHSQIWPAELLAYSGKGAKGGTPRQYGELNLPTEVVSSEFLTMEGRKFSSSKRVVIY
VRDLLSRYQPDAFRYFVAAAGPENQDSDFTWSEFVRRTNDELVAGWGNLVNRTANLIAKN
FGEIPKAGELTAADQALLDSVASAFGVVGDLIGRHRQKQAIGEAMRAVAEVNKYVSDTEP
WKIKDDPDRLGTILHVVAQCVADLNLILSPFLPFAANEVDRALGGSGEIAPMPRLEEVDD
LDGGAPYPIITGEYSGFPAWERRPIVPGTPVSKPTPIFTKLDPSIVDEELARLES
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcgtcctgtccgccgtcgcctggccgtacgccaacggcccgcgccacatcggc
cacgtcgccggtttcggcgtgccctccgacgtcttcagccggtacatgcggatggcgggc
cacgacgtgctcatggtctccggctccgacgagcacgggacaccgatcctgatcgcggcc
gacgaggccgggctctcgccgcaggagctggccgatcgcaaccaccggatcatcgccgag
gacctggcctcgctcggcctgacctacgacctctacacgcgcaccaccacccgcaaccac
cacgcggtcgtgcaggagctgttcctcggcgtctacgagaacgggtacttcgtcgagcag
acgacgtacggcgccatctcgccctcgaccgggcgcaccctgcccgaccgctacatcgag
ggcacctgcccgatctgcgggtacgacggcgcgcgcggcgaccagtgcgacaactgcggc
aaccagctggacccgcacgacctgatcgacccgcgctcgaagatcaacggcgagacgccg
gagttcatcgagacccagcacttcttcctcgacctgcccgcgctggccgaggcgctgggg
gagtggctcgacgggcgcgaggcgacggggctctggcggccgaacgtgatccggttcagc
cagaacatcctcaaggagatccggccgcgagcgatgacccgcgacatcgactggggcatc
gccgtacccctcgacggctggcgggagaacccgaccaagaggctctacgtctggttcgac
gcggtgatcggctacctgtcggcgtccatcgagtgggcccgccgtctcgacgagcccgac
cgctggcgcgactggtggaacgacccggacgccctgtcgtactacttcatgggcaaggac
aacatcaccttccacagccagatctggccggccgagctgctggcctactccggcaagggc
gcgaagggcggcacgccgcgacagtacggcgagctgaacctgcccaccgaggtcgtctcc
tcggagttcctcacgatggaggggcgcaagttctcctcctccaaacgggtcgtgatctac
gtgcgcgacctgctcagccggtaccagccggacgcgttccgctacttcgtcgcggccgcc
gggccggagaaccaggactccgatttcacctggtcggagttcgtgcgtcgcaccaacgac
gagctggtcgccggctggggcaacctggtcaaccgcaccgcgaacctgatcgcgaagaac
ttcggggagatcccgaaggccggcgagctcaccgcagcggaccaggctctcctggactcc
gtggcctcggcgttcggcgtcgtcggcgacctcatcggccggcaccggcagaagcaggcg
atcggcgaggcgatgcgggccgtggccgaggtcaacaagtacgtctccgacaccgagccg
tggaagatcaaggacgaccccgaccggctcggcacgatcctgcacgtcgtcgcccagtgt
gtggccgacctcaacctgatcctctcgccgttcctgccgttcgccgcgaacgaggtggac
cgggcgctgggcggctcgggcgagatcgccccgatgccgcgcctggaggaggtcgacgac
ctcgacggcggcgcgccgtacccgatcatcaccggggagtactccggcttccccgcctgg
gagcggcgcccgatcgtgcccggcaccccggtctcgaagcccacgccgatcttcaccaag
ctcgacccgtcgatcgtcgacgaggagctcgcccggctggagagctga

DBGET integrated database retrieval system