KEGG   Nocardioides sp. JS614: Noca_2150Help
Entry
Noca_2150         CDS       T00443                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00360  Phenylalanine metabolism
nca00362  Benzoate degradation
nca00620  Pyruvate metabolism
nca00621  Dioxin degradation
nca00622  Xylene degradation
nca00650  Butanoate metabolism
nca01100  Metabolic pathways
nca01120  Microbial metabolism in diverse environments
nca01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Noca_2150
   00650 Butanoate metabolism
    Noca_2150
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Noca_2150
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Noca_2150
   00622 Xylene degradation
    Noca_2150
   00621 Dioxin degradation
    Noca_2150
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Noca_2150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3 DapB_N
Motif
Other DBs
NCBI-ProteinID: ABL81659
UniProt: A1SIM4
Position
complement(2299475..2300419)
Genome map
AA seq 314 aa AA seqDB search
MTASTIPRQIAIIGSGNIGTDLMIKVLRLSKTLEVGAMVGIDPDSDGLARANRLGVPTTS
DGVDGLIRMPNFEAIDIVLDATSARAHAANYTALRRYRKRMIDLTPAAVGPFVVPAVNMG
ASLSADNVNMVTCGGQATIPIVAAISQVTPVAYAEIVASIASKSAGPGTRQNIDEFTETT
AHAIEQVGGARKGKAIIILNPAEPPLIMRDTVLALIGPSDHDAVKGSIRAMVDAVAEYVP
GYRLKQRIEIQPLDGLPVGTLTSEPVTHKVSVFLEVEGAAHYLPAYAGNLDIMTSAALRV
AEAMAAQKLSGAVA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcatcaacgattccccgtcaaatcgccatcatcggctccggcaacatcggtact
gatctgatgattaaggttctgcggctatcaaagacgcttgaggtcggagcgatggttggc
attgaccccgatagcgacgggctcgcacgcgcgaaccggctcggagtacctacgacctcg
gacggggttgacggcctgattcgcatgcccaacttcgaggccatcgacatcgtgctcgac
gcgacctctgcccgcgcccacgctgccaactacaccgccctcaggcgctaccgcaagcga
atgatcgacctgacacctgcagccgtcggaccgttcgtagtgcccgccgtcaacatgggc
gcgagcctctctgcagacaacgtcaacatggtgacgtgcggcgggcaagccactatcccg
atcgtcgcggcaatttcccaagtcactcctgttgcgtatgcggaaatcgtcgcttcaatt
gcatcgaagtcggcggggcctggaacacgtcagaacatcgatgagttcaccgagacgacg
gcccacgccatcgagcaggtcggcggtgcccggaaggggaaggccatcatcattctgaac
cctgcggagccacctctcatcatgcgtgacacggttcttgcgctcatcggaccttccgac
cacgacgcggtcaaggggtccatacgtgcgatggttgatgctgttgccgagtacgtcccc
gggtatcgcctcaagcagcgtattgaaattcagccgttggacggactgccggtcgggacg
ctcacctcggagcccgtcacacacaaggtgagcgtctttctggaagtagagggcgcagcg
cactacctgccggcatatgcaggcaatctcgacatcatgacctccgcagcgttgcgtgtt
gcggaagcgatggcagcccagaaactcagcggagcagtggcgtga

DBGET integrated database retrieval system