KEGG   Nocardioides sp. JS614: Noca_2509Help
Entry
Noca_2509         CDS       T00443                                 

Definition
(GenBank) adenosylcobyric acid synthase (glutamine-hydrolysing)
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00860  Porphyrin and chlorophyll metabolism
nca01100  Metabolic pathways
Module
nca_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Noca_2509
Enzymes [BR:nca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Noca_2509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 DJ-1_PfpI GATase GATase_5
Motif
Other DBs
NCBI-ProteinID: ABL82013
UniProt: A1SJM8
Position
2676234..2677721
Genome map
AA seq 495 aa AA seqDB search
MSGILVAGTSSDAGKSVVTTGLCRSLARAGVHVAPFKAQNMSNNSMVCADGAEIGRAQWV
QAVAANAEPEAAMNPVLLKPGSDLRSHVVVMGRPGGTLGADDFAEGREPLAAAAYAAFDD
LASRYDVVVAEGAGSPAEINLRSGDFVNMGLARHAGLPTVVVGDIDRGGLLAAMFGTVAL
LEPADQRLLAGFVVNKFRGDLDLLRPGLEEVARLTGRPVYGVLPWHPDLWMDSEDTLAVA
GRQARDGRAALKVAVVRLPRISNVTDVDALGIEPSLDVVFATDPRALSDADLVVLPGTRA
TIADLAWLRERGLDRAVHAHAAAGRPVLGICGGFQMLGRSVSDPGGVEGQPGAEVEGLAL
LDVRTDFSAVKVLRLSRGLALGASTAGYEIHHGRVTRGAGAEEFLGGAREGHVLGTMWHG
SLEGDAFRTAFLTEVARLTGHVWEPSGVSFAAAREGRMELLADLVEEHLDVAAIAALASE
GVPDGLPVLPPGADR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcctggtcgcgggcacgagctcggacgccggcaagagcgtcgtcaccact
ggactgtgccgctcgctggcgcgcgcgggtgtgcacgtcgcgccgttcaaggcgcagaac
atgtcgaacaactcgatggtctgcgcggacggcgcggagatcggccgggcgcagtgggtg
caggccgtggccgcgaacgccgagcccgaggcggcgatgaacccggtgctgctcaagccg
ggcagtgacctgcgcagccacgtcgtcgtgatgggtcgtcccggcggcacgctgggcgcg
gacgacttcgccgagggccgggagcccctggcggctgcggcgtacgccgccttcgacgac
ctggcgtcgcgctacgacgtcgtcgtcgcggagggcgccggcagtccagccgagatcaac
ctgcggtccggcgacttcgtgaacatggggctcgcgcggcacgccggcctgccgacggtg
gtcgtcggcgacatcgaccggggcggcctgctggcggccatgttcggcaccgtggcgctg
ctcgagcccgccgaccagcggctgctcgcggggttcgtcgtcaacaagttccgcggcgac
ctcgacctgctgcgacccgggctcgaggaggtcgcccggctcaccggccggccggtgtac
ggcgtgctgccgtggcaccccgacctctggatggactccgaggacaccctcgccgtcgcc
ggccggcaggcgcgcgacggccgggcggcgctcaaggtcgcggtcgtgcggctgccgcgg
atcagcaacgtgaccgacgtcgacgcgctcgggatcgagcccagcctcgacgtcgtcttc
gccaccgacccgcgagccctctcggacgccgacctggtcgtgctgcccgggacccgtgcg
accatcgcggacctcgcctggctgcgcgagcgggggctggaccgagccgtccacgcgcac
gccgctgccggtcgcccggtgctcgggatctgcgggggcttccagatgctcggccggtcc
gtctcggatccgggcggcgtcgaggggcagcccggcgccgaggtcgaggggctggcgctg
ctcgacgtacgcaccgacttctccgcggtgaaggtgctccggctctcccggggtctcgcg
ctcggcgcctcgaccgctggctacgagatccaccacgggagggtcacgcggggcgccggc
gccgaggagttcctcggcggggcccgggagggccacgtgctcggcacgatgtggcacggc
agcctcgagggcgacgccttccgcacggcgttcctgaccgaggtcgcgcggctgaccggt
cacgtgtgggagccttccggggtgagcttcgcggcggcacgggaggggcggatggagctg
ctcgccgacctcgtcgaggagcacctcgacgtcgccgcgatcgccgccctcgcctccgag
ggcgtacccgacggcctgccggtcctgccgccgggcgctgaccggtga

DBGET integrated database retrieval system