KEGG   Nocardioides sp. JS614: Noca_2600Help
Entry
Noca_2600         CDS       T00443                                 

Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00860  Porphyrin and chlorophyll metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01120  Microbial metabolism in diverse environments
Module
nca_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Noca_2600
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Noca_2600
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Noca_2600
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Noca_2600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 XdhC_C Shikimate_DH Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABL82104
UniProt: A1SJW9
Position
2765623..2766846
Genome map
AA seq 407 aa AA seqDB search
MDEYSTYPSGLRLSGRRVVVVGGGQVAQRRVPHLIAAGADVHVVSPQVTPAIEGMVGSGE
VTWHERGFADTDLDEAWYVVAATDDHAVNEQVSDAAEARRVFCVRSDDASRASAWTPAVG
RHAGVTVAVLGQREPRRSAAVRDEILEGLREGTIVARHQRDRSAGVVLVGGGPGDPELMT
VAGRKALVEADVVVADRLAPRELLGELPADVELIDVAKLPRGRSALQEEINRVIIERARA
GKRVVRFKGGDNFVFGRGFEEVIACREAGVPVTVVPGLTSSIAVPAVAGIPVTHRGVAHE
FTIVSGHLPPGHPQSQVNWTALGALRGTVVLMMAVENAPRIATALVAGGRAGSTPVAVVC
EGTMPGERTVLATLDTLATRLEEESVRPPAVIVVGEVVRVAHPRHFA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtactcgacgtacccctcggggctgcggctgtccggacgccgggtcgtggtg
gtcggcggggggcaggtggcccagcgccgcgtgccgcacctgatcgcagcgggcgccgac
gtgcacgtggtcagcccgcaggtgacgccggcgatcgagggcatggtcggctcgggcgag
gtgacctggcacgaacgcggctttgcagacaccgacctcgacgaggcgtggtacgtcgtc
gccgcgaccgacgaccacgcggtgaacgagcaggtgtcggacgcggccgaggcgcggcgc
gtgttctgcgtgcggtccgacgacgccagccgcgcgagcgcgtggacgccggcggtcggg
cggcacgcgggcgtcacggtcgccgtgctcggccagcgcgagccgcgacggtcggcggcg
gtgcgcgacgagatcctcgagggcctgcgcgagggcacgatcgtcgcccggcaccagcgc
gaccgcagcgccggcgtggtcctggtgggcgggggcccgggcgaccccgagctgatgacc
gtggccggccgcaaggcactggtcgaggcggacgtcgtggtcgccgaccggctggcgccg
cgcgagctgctcggcgagctgcccgccgacgtcgagctgatcgacgtcgcgaagctcccc
cggggccggtcggccctgcaggaggagatcaaccgcgtcatcatcgagcgggcccgggcg
ggcaagcgggtggtccgcttcaagggcggcgacaacttcgtcttcgggcgcgggttcgag
gaggtcatcgcgtgccgcgaggccggcgtgccggtcacggtcgtgccggggctgaccagc
tcgatcgccgtacccgcggtcgccgggatcccggtgacccaccgcggggtggcgcacgag
ttcaccatcgtgtccgggcacctgccacccggacacccgcagtcgcaggtcaactggaca
gcgctcggcgcgctgcgcggcaccgtcgtgctgatgatggcggtcgagaacgcaccccgg
atcgcgaccgcactcgtcgcgggcggccgggcgggctcgacgccggtggccgtggtctgt
gagggcacgatgccgggggagcggaccgtcctcgcgaccctcgacaccctggccacgcgt
ctggaggaggagtccgtgcggccgcccgcggtcatcgtggtgggcgaggtggtccgggtg
gcccatccgcgacactttgcgtga

DBGET integrated database retrieval system