KEGG   Nocardioides sp. JS614: Noca_3483Help
Entry
Noca_3483         CDS       T00443                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00030  Pentose phosphate pathway
nca00051  Fructose and mannose metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01120  Microbial metabolism in diverse environments
nca01130  Biosynthesis of antibiotics
nca01200  Carbon metabolism
nca01230  Biosynthesis of amino acids
Module
nca_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
nca_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Noca_3483
   00051 Fructose and mannose metabolism
    Noca_3483
Enzymes [BR:nca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Noca_3483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB
Motif
Other DBs
NCBI-ProteinID: ABL82983
UniProt: A1SME8
Position
complement(3693250..3693738)
Genome map
AA seq 162 aa AA seqDB search
MRVHLGCDHAGLDLKDHLSRWLTDHGYEPVDHGPFAYDALDDYPVFCLRAAAAVAEERAA
GRDSLGVVIGGSGNGEQMAANKVHGIRCALVWSEETAVLARQHNDANVVSVGGRMHSLED
MTRFVEIFLAEPFSGEERHVRRIGQLAAYESTGELPALPGDA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgcacctcggctgcgaccatgccggactcgacctcaaggaccacctcagtcgc
tggctcaccgaccacggctacgagcccgtggaccacggcccgttcgcctacgacgccctc
gacgactaccccgtgttctgcctgcgcgccgcggcggcggtggccgaggagcgggccgcc
gggcgggacagcctgggcgtggtgatcggcggctccggcaacggcgagcagatggccgcg
aacaaggtgcacggcatccggtgtgcgctggtctggtcggaggagaccgcggtcctcgcc
cgtcagcacaacgatgccaacgtcgtctcggtcggcggccggatgcactccttggaggac
atgacccgcttcgtcgagatcttcctcgccgagccgttcagcggcgaggagcgacacgtg
cgtcggatcgggcagctggcggcgtacgagagcaccggcgagctccccgccctccccggc
gatgcctga

DBGET integrated database retrieval system