KEGG   Nocardioides sp. JS614: Noca_3493Help
Entry
Noca_3493         CDS       T00443                                 

Definition
(GenBank) membrane-flanked domain
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: bPH_2 DUF3043
Motif
Other DBs
NCBI-ProteinID: ABL82993
UniProt: A1SMF8
Position
complement(3702111..3702611)
Genome map
AA seq 166 aa AA seqDB search
MAISHKLLNEGETVVVDTRTHVKALIVPLLVLVVLLAIGTFVQVQWDQTLAYVVWAVVAV
GIIWYVLRPAIIWATASYTFTNRRLITRSGVLVRRGHDMPLARISDIAYEFGLIDRMLGC
GTLIISDASEHGQIRLHDIPRVEETQRKVNAMLQSLNHPSAGHDGT
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtggccatctcgcacaagctgctgaacgagggtgagaccgtcgtcgtcgacacccgtacg
cacgtcaaggcgctgatcgtcccgctcctcgtcctggtcgtcctgctggcgatcggcacc
ttcgtccaggtccagtgggaccagacgctcgcgtacgtggtgtgggcggtcgtggcggtc
gggatcatctggtacgtgctgcgcccggcgatcatctgggcgaccgcgtcgtacacgttc
acgaaccggcggctgatcacccgcagcggcgtgctcgtgcggcggggccacgacatgccg
ctggcgcggatcagcgacatcgcctacgagttcgggttgatcgaccggatgctcggctgc
gggacgctgatcatctccgacgccagcgagcacgggcagatccggctgcacgacatcccg
cgggtcgaggagacccagcgcaaggtcaacgccatgctgcagagcctcaaccacccctcg
gcaggacatgacgggacctga

DBGET integrated database retrieval system