KEGG   Nocardioides sp. JS614: Noca_3501Help
Entry
Noca_3501         CDS       T00443                                 

Definition
(GenBank) Cellulase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00500  Starch and sucrose metabolism
nca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Noca_3501
Enzymes [BR:nca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Noca_3501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-ProteinID: ABL83001
UniProt: A1SMG6
Position
complement(3709635..3710675)
Genome map
AA seq 346 aa AA seqDB search
MRRRPSPTASSIRPPVLMLVALVAAVLALGGCSGGGEPDDAPSSADPVADNPYAGRTGFA
DPASRTAQAAAQAKADGDVEAERVLSRLASTPQGIWLTPEEYPPGSVAPLVARVVRAADA
AGQVPTFVVYGIPDRDCTGGFSGGGLTADQYGPWVQEIADAVSGADPSVPVVAVVEPDAL
ASAIACDRRSERVRLIADAVTRLADAEVTTYVDGGHSHWIEPDQLARLLEQAGIDQARGF
ATNVSNYQTDADERAYGEQLSALLDGAHYIVDTGRNGNGSTEDWCNPTGRAYGTDPAPAP
EGDAEHLDAYVWVKPPGESDGECGGGPPAGRFWRERALEMAVSSGW
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgccgcccctcgccgaccgcctcgtcgatccggcccccggtcctgatgctggtc
gccctggtggccgccgtgctcgcgctcggcgggtgctcgggcggcggcgagccggacgac
gcgccgagcagcgcggacccggtcgcggacaacccctacgcgggccggaccggcttcgcc
gacccggcctcgcggaccgcccaggccgcagcgcaggcgaaggcggatggtgacgtcgag
gcggagcgggtcctctcccggctcgccagcacgccgcaaggcatctggctgacgcccgag
gagtacccgcccggctcggtcgcgccgttggtcgcgcgggtcgtccgggccgccgacgca
gccggccaggtgccgacgttcgtcgtgtacggcatccccgaccgcgactgcaccggcggc
ttctccggcggtggcctgaccgcggaccagtacgggccctgggtgcaggagatcgcggac
gccgtctcgggcgccgacccctcggtcccggtcgtggcggtcgtcgagccggacgcgctc
gcctcggcgatcgcgtgcgaccgccgctcggagcgggtgcggctgatcgccgacgccgtg
acccggctcgccgacgccgaggtgacgacctacgtcgacggcggccactcgcactggatc
gagccggatcagctggcgaggctgctcgagcaggccgggatcgaccaggcccggggcttc
gccaccaacgtctcgaactaccagaccgacgccgacgagcgtgcgtacggcgagcagctc
agcgccctgctcgacggagcccactacatcgtcgacaccggacggaacggcaacggctcg
accgaggattggtgcaacccgaccggtcgggcctacggcaccgacccggcgccggcgccg
gagggcgacgcggagcacctcgacgcctacgtctgggtcaagccgccgggggagagcgac
ggcgagtgcggaggcgggccgcccgccgggcgcttctggcgtgagcgggcgctggagatg
gccgtctcgtccgggtggtga

DBGET integrated database retrieval system