KEGG   Nocardioides sp. JS614: Noca_3505Help
Entry
Noca_3505         CDS       T00443                                 

Definition
(GenBank) GtrA family protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GtrA
Motif
Other DBs
NCBI-ProteinID: ABL83005
UniProt: A1SMH0
Position
complement(3713345..3713923)
Genome map
AA seq 192 aa AA seqDB search
MGGRWERVFTEAYRFLAVGGIATIVAFVIFNFLVHGFNTEHQALLDGQPYLGYVIANTVG
MTISYRGSRTWVFKHRPPRSADGGRTAFIAINVVTMLLPIACLWLSRDVLGLDDPWSDNI
SANVIGLFFGLVARFYLFRTLVFKRPVHLPDLMHNPLQVFELNELADPDVAPVVLTDSTD
PSRSDPARRPGP
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggaggccggtgggaacgcgtcttcaccgaggcgtaccggttcctcgctgtgggcggc
atcgcgacgatcgtcgcgttcgtgatcttcaacttcctggtgcacgggttcaacaccgag
caccaggcgctgctcgacggccagccttacctcggctacgtcatcgccaacacggtcggc
atgacgatcagctaccgcggcagccgcacctgggtgttcaagcaccggccgccccgctcg
gccgacggcggccgcacggcgttcatcgcgatcaacgtcgtcacgatgctgctccccatc
gcgtgcctgtggctgagccgcgacgtgctcggcctcgacgacccctggtcggacaacatc
tcggcgaacgtgatcggcctgttcttcggcctcgtggcgcgcttctacctgttccgcacc
ctggtcttcaagcggcccgtgcacctgccggacctgatgcacaacccgctccaggtcttc
gagctcaacgagctcgccgaccccgacgtggcgcccgtggtgctcaccgactccacagat
ccgtccaggagtgacccagctcggcgaccaggtccctga

DBGET integrated database retrieval system