KEGG   Nocardioides sp. JS614: Noca_3514Help
Entry
Noca_3514         CDS       T00443                                 

Definition
(GenBank) benzoate transporter
  KO
K05782  benzoate membrane transport protein
Organism
nca  Nocardioides sp. JS614
Brite
Transporters [BR:nca02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Noca_3514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BenE
Motif
Other DBs
NCBI-ProteinID: ABL83014
UniProt: A1SMH9
Position
3724989..3726074
Genome map
AA seq 361 aa AA seqDB search
MVVLTGLVAIGATAAEAASGLLVLCVTQALGMLWLAVRHRIPITLAWSTPGAALLLSTGT
VSGGWPAAVGAFVVTGVLIVLTGLVPALGELIARIPTSLARAMLAGVLLPICLEPVTGLA
DSPTYVGPVVLAWLVMHRVSRRWAVPVALAVALVVVLVAAGSSVSAPDLVPALAWTTPHW
TVSSAMSLAVPLYIVTMASQNVPGVAVTSSFGYQIPWRETMTVTGVGTLAGAPFGGHAIN
LAAITAALAAGPAAGEDRSRRWIACVSASGTYLVLALGCGALTTLVAAAPGDVMQAAAGL
ALLGTLGAALAGALDDEGGREAVVVCFLVAASGITVLGIGAAFWALVAGLVLRPVLSERR
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtcctgaccgggctcgtcgcgatcggcgcgacggcggccgaggccgcgtccggc
ctgctcgtcctgtgcgtgacccaggcgctcggcatgctctggctcgcggtccggcaccgc
atcccgatcacgctcgcgtggtcgaccccgggggcggccctgctgctgtccaccggcacg
gtctccggcggctggccggccgcggtcggggcgttcgtggtgaccggcgtcctgatcgtg
ctcaccggcctggtcccggcgctcggcgagctgatcgcccggatcccgacctcgctggcg
cgcgcgatgctcgccggcgtgctgctgccgatctgcctggagccggtgaccggcctggcc
gactcgccgacgtacgtcggtccggtcgtgctcgcctggctggttatgcaccgggtctcc
cgccggtgggcggtgccggtcgcgctcgcggtcgccctggtggtggtgctcgtggcggcc
ggctcctcggtctcggcccctgacctggtcccggcgctcgcctggaccacgccgcactgg
acggtgtcgagcgcgatgagcctcgccgtaccgctctacatcgtgaccatggcctcgcag
aacgtccccggcgtcgcggtcacgtccagcttcggctaccagatcccgtggcgcgagacg
atgacggtcaccggcgtcggcaccctcgccggcgcgccgttcggcgggcatgcgatcaac
ctggcggcgatcacggcggcgctcgcggcgggccccgccgcgggcgaggaccgctcccga
cgctggatcgcgtgcgtcagcgcgtcgggcacctacctggtgctcgcgctcggctgcggg
gcgctcaccaccctggtcgccgccgcgcccggtgacgtcatgcaggccgccgccggcctc
gcgctgctcgggacgctcggcgccgccctggccggcgccctcgacgacgagggcggtcgg
gaggccgtcgtcgtgtgcttcctcgtcgccgcctccggcatcaccgtactcggcatcggc
gcggccttctgggcgctggtcgccgggctggtgctccgcccggtgctcagcgagcggcga
ccctga

DBGET integrated database retrieval system