KEGG   Nocardioides sp. JS614: Noca_3515Help
Entry
Noca_3515         CDS       T00443                                 

Definition
(GenBank) SpoIID/LytB domain
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIID
Motif
Other DBs
NCBI-ProteinID: ABL83015
UniProt: A1SMI0
Position
complement(3726055..3727308)
Genome map
AA seq 417 aa AA seqDB search
MRLGFPSVTVVPEVTMRAVSSLLALALTTPMLAAGALATAGPAAAAEAEADVWKVPSHAS
ITIKGRGYGHGHGMSQYGAEGAARQGLTHREIAEFYYPGTEWGTSKGRISVLLTADTTDD
LVVNARSGLTVRDTAVKGRVALPDNGAKRWRVAVGKDGVNRVSYRDRRWQPWRDLTGQGE
FYAGGEPVTLVTPSGERSYRGRLRVAVTATGERVTVNDVDLESYLRGVVPLEIPALWSTE
AVRAQAVAARTYASYERRHPQSRAYQLCDTWSCQVYGGVDAEHPASDRAVDATAGSILTS
DGAPAFTQFGSSSGGWTSAGSVPYLPAKRDPYDGWSGNPVHTWTTTVDDARLEQAWPALG
DLRRIAVTARDGNGRWGGRVRTIAMRGSQGKVVVSGDTFRAVLGLRSTWVTFRVAAR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcgattggggttcccatccgtcacagtcgtcccagaggtcaccatgcgcgccgtgtcg
agcctgctcgcgctcgcgctgacgaccccgatgctggccgcgggcgcgctggcgaccgcc
ggcccggccgcggccgcggaggcggaggcggacgtctggaaggtgccctcgcacgcgagc
atcacgatcaagggtcgcggctacgggcacggccacgggatgtcgcagtacggcgccgag
ggcgccgcccgccagggcctcacccaccgcgagatcgcggagttctactaccccggcacc
gagtgggggaccagcaagggccggatcagcgtgctgctgaccgccgacaccaccgacgac
ctggtcgtgaacgcccggtccgggctcaccgtccgcgacaccgcggtcaagggccgggtc
gcgctgcccgacaacggcgcgaagcgctggcgggtcgcggtcggcaaggacggggtgaac
cgcgtctcctaccgggaccggcgctggcagccgtggcgggacctgacgggccagggcgag
ttctacgcgggcggtgagccggtcacgctggtcaccccgagcggtgagcgctcctaccgg
ggccggctccgcgtcgcggtgaccgccaccggcgagcgggtcacggtcaacgacgtcgac
ctggagagctacctcaggggcgtcgtcccgctggagatcccggcgctgtggagcaccgag
gcggtccgcgcccaggcggtggcggcccgcacctacgcgtcgtacgagcgccggcacccg
cagtcgcgggcctatcagctctgcgacacctggtcctgccaggtctacggcggggtcgac
gcggagcaccccgcctccgaccgagccgtcgatgccaccgccgggtcgatcctcaccagc
gacggcgcgccggcgttcacccagttcgggtcgagcagcggcggttggacgtcggcgggc
tcggtgccctacctgccggccaagcgtgacccgtacgacggctggtcgggcaacccggtg
cacacctggaccacgaccgtcgacgacgcgcgcctcgagcaggcctggcccgcgctcggt
gatctgaggcggatcgcggtcaccgcgcgggacggcaacggccgttggggcggccgggtc
cgcacgatcgcgatgcgcggcagccagggcaaggtcgtcgtctccggggacacgttccgg
gccgtgctcgggctgcgctcgacctgggtgaccttcagggtcgccgctcgctga

DBGET integrated database retrieval system