KEGG   Nocardioides sp. JS614: Noca_3516Help
Entry
Noca_3516         CDS       T00443                                 

Definition
(GenBank) SpoIID/LytB domain
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIID
Motif
Other DBs
NCBI-ProteinID: ABL83016
UniProt: A1SMI1
Position
complement(3727351..3728505)
Genome map
AA seq 384 aa AA seqDB search
MIRRLAVLLTAAALAAPVAPAYAERSERAPVQREPASVTISTWGNGHGKGLSQYGARNRA
DAGESYGQILDHYYPGTSQGSARGSIRVLLSAAPGGRMTIQARSGVKARAGTRTWTLPTR
RDGKSVKLWRVRRAGERWELAYRTGSWHVWRTTRVAAAFASRQPMALVKAATYRGVLRLT
PSGVVNTVGLENYVRGVVAQEMPASWSPAAVQAQAVAARTYAVFERGNVAAGRDYDLCDT
SACQVYLGAAGEHPASDAAVAATAGEVRSYGGEPIFAQFSASNGGYSVDGGYPYLVAAPD
DQDHGYPGDPASRTFTGDEITRHWTGLGDLVSVEVLERDGNGTAQVPGGRATLLRVTGTK
GEVDVSGSAFRSYLGLRTTLLEIT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatccgacggctcgccgtcctgctgacggccgccgccctcgccgcgccggtcgctccg
gcctacgccgagcggtctgagcgggcgcccgtccagcgggagccggccagcgtcaccatc
tccacgtggggcaacggccacggcaagggcctctcgcagtacggcgcccgcaaccgcgcc
gacgcgggggagagctacggccagatcctcgaccactactacccgggcacgtcgcaggga
agcgcccgcggcagcatccgggtgctgctgagcgccgcaccgggcggtcggatgaccatc
caggcacgctcgggcgtcaaggcacgggcaggaaccaggacctggacgctgcccacccgt
cgcgacggcaagtccgtcaagctctggcgggtccggcgcgcgggcgagcggtgggagctg
gcctaccgcaccggctcctggcacgtgtggcgcacgacgcgggtcgcggcagcgttcgcg
tcccggcagccgatggccctcgtgaaggcggcgacgtatcgcggcgtgctccgtctcacc
ccgtccggcgtggtcaacacggtcggtctcgagaactacgtccgcggggtcgtggcccag
gagatgccggcgagctggtcgccggcggccgtgcaggcccaggcggtggcggcgcgcacg
tacgccgtcttcgagcgtggcaacgtggcagcgggccgcgactacgacctgtgcgacacc
tcggcctgccaggtctacctcggcgcggcgggggagcaccccgcctccgacgccgccgtc
gccgcgaccgcaggcgaggtccgcagctacggcggcgagccgatcttcgcccagttctcc
gcgagcaacggcggctacagcgtcgatggcggttacccgtacctggtggctgcgcccgac
gaccaggaccacggctatcccggcgatccggcgagccggacgttcaccggcgatgagatc
acccgccactggaccgggctcggtgacctggtgtcggtggaggtgctcgagcgcgacggc
aacggcaccgcgcaggtgccggggggccgggcgacgctgctgcgggtcaccggcaccaag
ggcgaggtggacgtcagcggctcggccttccgctcctacctgggcctgcgcaccacgctg
ctggaaattacataa

DBGET integrated database retrieval system