KEGG   Nocardioides sp. JS614: Noca_3526Help
Entry
Noca_3526         CDS       T00443                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K01840  phosphomannomutase [EC:5.4.2.8]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00051  Fructose and mannose metabolism
nca00520  Amino sugar and nucleotide sugar metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Noca_3526
   00520 Amino sugar and nucleotide sugar metabolism
    Noca_3526
Enzymes [BR:nca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     Noca_3526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV TetR_N
Motif
Other DBs
NCBI-ProteinID: ABL83026
UniProt: A1SMJ1
Position
3736942..3738594
Genome map
AA seq 550 aa AA seqDB search
MTSADVSSLLRTARAWVADDPDDQTRAELEAVIAEVESGGPADDLRDRFAGTLEFGTAGL
RGALGAGSNRMNRVVVIRAAAGLAAYLKDTGTERGSVVIGYDARHNSDVFARDTAEVMTG
AGLTAYLLPRPLPTPLLAYAIRELGCAAGVMVTASHNPPQDNGYKVYLGDGSQIVPPADA
EIAARIAAVGAVADVPRGSGGTVLEEEIVDRYLDTVAGLAEDGPRDLSVVYTPLHGVGGT
TVQRVLEAAGFSEPAVVVQQELPDADFPTVAFPNPEEPGAMDLAMELARARGADLVVAND
PDADRCAAAVPGPHSWRMLRGDEVGALLAHALLSRGKQGTYATSIVSSSLLGKMARAAGR
PYAETLTGFKWIGRVEGLAFGYEEALGYCVDPEHVKDKDGVSALLLLCELAAAAKAEGRG
LVDLLDDLAVEHGLHATDQLSVRVSDLGEIAAAMARLRATPPAALGGLAVERAEDLSTGS
ADLPPTEGLRYLLADGARVVVRPSGTEPKLKCYLEVVVPVDAEGGVDAARIAAAGRLDAL
RDGIKQAAGI
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgccgatgtgagcagcctgctccggaccgcccgtgcctgggtggccgacgac
cccgacgaccagacccgtgccgagctcgaggcggtgatcgcggaggtggagtcgggcggt
cccgccgacgacctgcgcgaccgcttcgccgggaccctcgagttcggcaccgccgggctg
cgtggcgcgctcggcgcgggttccaaccggatgaaccgggtcgtggtgatccgcgccgcg
gccgggctcgcggcgtacctcaaggacaccggcaccgagcgcggctccgtggtgatcggg
tacgacgcgcggcacaactccgacgtcttcgcgcgcgacaccgcggaggtgatgacgggc
gccgggctgaccgcctacctcctgccgcggccgctgccgacgccgctgctggcctacgcg
atccgcgagctcggctgcgccgcgggcgtgatggtgacggcgagccacaacccgccgcag
gacaacggctacaaggtctacctcggcgacggcagccagatcgtcccgcccgccgacgcc
gagatcgcggcgcggatcgcggcggtcggcgcggtggccgacgtcccgcgcgggagcggc
ggcaccgtgctcgaggaggagatcgtcgaccgctacctcgacaccgtggcggggctcgcc
gaggacggcccgcgcgacctgtcggtcgtctacaccccgctgcacggcgtgggcggtacg
acggtccagcgggtgctcgaggccgcaggcttctccgagcccgcggtcgtcgtccagcag
gagctgcccgacgccgacttcccgaccgtcgcgttcccgaaccccgaggagccgggcgcg
atggacctggcgatggagctggcccgggcgcgcggtgcggacctggtcgtcgcgaacgac
ccggacgcggaccggtgcgcggcggccgtgcccggcccgcacagctggcggatgctgcgc
ggcgacgaggtcggggcgctgctcgcccacgcgctgctgagccgcggcaagcagggcacc
tacgccaccagcatcgtgtcgtcgagcctgctcgggaagatggcgagggcggccggccgg
ccctacgccgagaccctgaccggcttcaagtggatcggccgggtcgaggggctcgcgttc
ggctacgaggaggcgctcggctactgcgtcgaccccgagcacgtgaaggacaaggacggc
gtctccgccctgctgctgctctgcgagctcgcggccgccgcgaaggccgagggccgcggg
ctggtggacctgctcgacgacctggccgtcgagcacggcctgcacgcgaccgaccagctc
tcggtacgggtctccgacctcggcgagatcgccgcggcgatggcccggctgcgggcgacc
ccgcccgccgcgctcggcgggctcgccgtcgagcgcgcggaagacctgtcgaccggcagc
gcggacctgccgccgaccgaggggctgcgctacctgctggccgacggcgcgcgcgtcgtg
gtgcgcccgagcggcaccgagccgaagctgaagtgctacctcgaggtcgtggtgcccgtc
gacgccgaaggcggagtggatgcggcccggatcgctgccgccggccggctcgacgcgctg
cgtgacggcatcaagcaggctgccggcatctag

DBGET integrated database retrieval system