KEGG   Nocardioides sp. JS614: Noca_3527Help
Entry
Noca_3527         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Synaptobrevin DUF5336
Motif
Other DBs
NCBI-ProteinID: ABL83027
UniProt: A1SMJ2
Position
complement(3738591..3739193)
Genome map
AA seq 200 aa AA seqDB search
MDHNRESALMTDPSPDAVVERFHATNGRISGYLGLVCAGIVLALAIASWGGEHAPVVAVA
ALLGALLVWVALLRPALWAGRDDLVMRGMLHTDHVPLASITKVVVGQVLAVVAADKRYTS
PVVGYTARQTLRNRAGAARNRPAPTAMDTYQVFVEERITHLSREARELHHDAGEVRRTLA
WPEIAGVVVLVAALVVALVV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggaccacaaccgggagagtgccctcatgaccgaccccagccccgacgccgtcgtggag
cgtttccacgcgacgaacgggcggatcagcggctacctcgggctggtctgcgcgggcatc
gtgctggcgctcgcgatcgcctcctggggcggtgagcacgcgcccgtcgtcgccgtcgcg
gcgctgctcggggcactgctcgtctgggtggcgctgctgcgcccggcactgtgggccggc
cgcgacgacctggtgatgcggggcatgcttcacaccgaccacgtccccctcgcctcgatc
acgaaggtggtggtcggtcaggtgctcgccgtggtcgcggcggacaagcgctacacctcc
ccggtggtcggctacaccgcccgccagaccctgcgcaaccgtgctggtgctgctcgcaac
cgcccggccccgaccgcgatggacacctaccaggtgttcgtcgaggagcggatcacccac
ctctcccgcgaggcccgggagctgcaccacgacgccggggaggtacgccgtaccctcgcc
tggcccgagatcgccggcgtggtcgtgctggtggcggccctggtggtcgccctggtggtc
tag

DBGET integrated database retrieval system