KEGG   Nocardioides sp. JS614: Noca_3539Help
Entry
Noca_3539         CDS       T00443                                 

Definition
(GenBank) nucleoside ABC transporter membrane protein
  KO
K02057  simple sugar transport system permease protein
Organism
nca  Nocardioides sp. JS614
Module
nca_M00221  Putative simple sugar transport system
Brite
KEGG Orthology (KO) [BR:nca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nca02000]
    Noca_3539
Transporters [BR:nca02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    Noca_3539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ABL83039
UniProt: A1SMK4
Position
complement(3749573..3750688)
Genome map
AA seq 371 aa AA seqDB search
MTGRLTRVLLALSTPVLALASAFAITSLVLLAAGDPVIDVWDQILSVPEKRNLANIIDNA
TVLYLSGIAVAVGFRMNLFNIGVDGQYRVAAFTGAVVAGEAWLPGYLNTALAIVCAMAVG
AIWAGIAGVLRATRGVSEVISTIMLNAIATFLVAYLLRQVAVREEGSNQIGTKEIPEGSR
IPNIGIGGGYEIYGFIIIAAVVGFAFWFVLNRTRFGFDLRATGQSTTAAVASGISVKRMT
VTAMLISGGLAGLVGLPILFGDSYTYGSTFQSGLGFAGIAIALLGRNNPIGIALGALLFA
YLDEQSNPLQILVGVAPDIVAITQGVIVLTVVISYEIVRRYRHRLEQQQVARALEGERNE
TSNDTAEEVKA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggcggctgacccgggtgctgctcgccctcagcacgcccgtcctggcgctcgcc
tcggcgttcgcaatcaccagcctggtgctgctcgcagccggcgatccggtgatcgacgtc
tgggaccagatcctctcggtccccgagaagcgcaacctggcgaacatcatcgacaacgcc
accgtgctctacctctccggcatcgcggtggccgtcggcttccggatgaacctgttcaac
atcggcgtcgacgggcagtaccgggttgcggcgttcaccggcgccgtcgtcgccggcgag
gcctggcttccgggctacctcaacaccgcgctggcgatcgtctgcgcgatggcggtgggt
gcgatctgggccggcatcgcgggcgtgctgcgggcgacccgcggcgtcagcgaggtcatc
tccacgatcatgctcaacgcgatcgcgaccttcctggtcgcctacctgttgcgccaggtc
gcggtgcgcgaggagggcagcaaccagatcggcaccaaggagatccccgagggcagccgg
atccccaacatcgggatcggcggtggctacgagatctacggcttcatcatcatcgccgcc
gtggtcgggttcgcgttctggttcgtcctcaaccgcacccggttcggcttcgacctgcgc
gcgaccgggcagtcgaccaccgcagcggtcgcgagcggcatcagcgtgaagcggatgacc
gtcaccgcgatgctgatctccggcggcctcgccgggctggtcggcctcccgatcctgttc
ggcgactcctacacctacggctcgacgttccagtccggcctcggcttcgccggcatcgcg
atcgcgctgttgggccgtaacaacccgatcgggatcgcgctcggcgcgctcctgttcgcc
tacctcgacgagcagtccaacccgctgcagatcctggtcggcgtcgcgcccgacatcgtc
gccatcacccagggcgtgatcgtgctgaccgtcgtcatctcctacgagatcgtgcgccgc
taccgccaccgcctcgaacagcagcaggtggcccgcgccctcgagggcgaacgcaacgag
acatcgaacgacacggccgaggaggtcaaggcatga

DBGET integrated database retrieval system