KEGG   Nocardioides sp. JS614: Noca_3560Help
Entry
Noca_3560         CDS       T00443                                 

Definition
(GenBank) major facilitator superfamily MFS_1
  KO
K19577  MFS transporter, DHA1 family, inner membrane transport protein
Organism
nca  Nocardioides sp. JS614
Brite
Transporters [BR:nca02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    Noca_3560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4 Chs3p
Motif
Other DBs
NCBI-ProteinID: ABL83060
UniProt: A1SMM5
Position
complement(3775561..3776796)
Genome map
AA seq 411 aa AA seqDB search
MTTTAPAAGLAPSSRASHFALAVLALALGGFAIGTTEFVTMGLLPQIADGIDVSIPTAGH
VISAYALGVVVGAPLIAVLGARLPRRGLLVGLMVAYAAFNLLSAVATGYGVLFVARFLDG
MPHGAYFGVASLVAASLAPPARRGRAVASVMLGLSVANVVGVPAATWLGQQAGWRAAYLS
TALISAATIVMVLLFVPSCPGNPAATGRRELQFFRNGQAMLTLLAGAVGFGGLFAVYSYI
APTVTEVGGLAESAVPVFTAAFGVGMVAGTWLAGRLAEWSVLRSLIWSGIGSGLVMLVVW
AAAPHGWLLLPAVFLVTAIGSVLVINLQLRLMAVSGEAQTLGAAMNHASLNLANALGAWL
GGLVIAAGYGYRAPALVGGALSVVGVAVLLWSASVHGREERASAYSEASSS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaccgcgcccgcagcggggctggcgccgagcagccgcgcctcgcacttcgcg
ctcgcggtgctggccctcgcgctcggcggcttcgcgatcggcaccaccgagttcgtgacg
atggggctgctgccgcagatcgcggacgggatcgacgtctcgatcccgaccgccggccac
gtgatctcggcgtacgcgctcggcgtcgtcgtcggcgccccgctgatcgcggtgctcggc
gcccggctcccgcggcgcgggctgctggtcgggctgatggtcgcctacgccgcgttcaac
ctgctcagcgcggtggcgaccgggtacggcgtgctcttcgtcgcccggttcctcgacggg
atgccgcacggcgcctacttcggggtcgcctcgctggtcgccgcgagcctcgcgccgccg
gcccggcgtggccgcgccgtggcctcggtgatgctcgggctctcggtcgccaacgtggtc
ggcgtccccgccgcgacctggctgggccagcaggcgggctggcgcgcggcgtacctctcg
acggcgctcatctcggccgcgacgatcgtgatggtcctgctcttcgtgccctcgtgcccc
ggcaaccccgccgcgaccgggcgtcgcgagctgcagttcttccgcaacgggcaggcgatg
ctgaccctgctggcgggtgccgtcggcttcggcgggctgttcgcggtctactcctacatc
gcccccaccgtcaccgaggtcggcgggctcgcggagtccgccgtgccggtgttcaccgcc
gccttcggcgtcggcatggtcgccggcacctggctggccggccggctggcggagtggtcg
gtcctccggtcgctgatctggtccggcatcggctccggcctggtcatgctggtcgtctgg
gcggccgccccgcacgggtggctgctgctgccggcggtgttcctggtcaccgcgatcggc
tcggtcctggtgatcaacctccagctgcggctgatggcggtctccggcgaggcgcagacg
ctgggcgccgcgatgaaccacgcgtcgctcaacctcgccaacgccctcggcgcctggctc
ggcggcctcgtgatcgccgcgggctacggctaccgcgcgcccgcgctcgtcgggggcgcg
ctctcggtggtcggggtggccgtgctgctgtggtcggcctcggtccacgggcgcgaggag
cgcgcctcggcgtactccgaggccagcagctcgtag

DBGET integrated database retrieval system