KEGG   Nocardioides sp. JS614: Noca_3567Help
Entry
Noca_3567         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABL83067
UniProt: A1SMN2
Position
complement(3783296..3784030)
Genome map
AA seq 244 aa AA seqDB search
MTQPGQSIEQYLEQQRFKWFWMLWDAHHARVGWITVGVLLGFMVGWWVGGLTSCAASDHG
CEVKVGAVEAAGTWFGAIGALLAVGAGIASFRSVERQRLVEQRRLLMSRSERDEADLEEA
SNVQVHCQIGVYQGELVREIRATVVNNLSEQKVHKITGEWDGFGSLKPVHTLDAGRSHTT
RLTLDSPRTRPGGRAELRLPPSKHAEWAQAQRANVRIKYEIRGQWFERVGDAPPVRFKAP
ALQV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcagcccggccagtcaatcgagcagtacttggagcaacagcggttcaaatggttc
tggatgctctgggacgcccaccacgccagagtcggatggataaccgtcggagtactcctc
ggcttcatggtcggatggtgggtcggtggcttgacctcttgcgcggcatccgaccacggc
tgcgaggtcaaggtaggcgcggtcgaggctgcggggacatggtttggcgcaatcggtgcc
ctgcttgcagttggcgccggtatcgcgagcttccggtctgtcgagcggcagcgtctcgtc
gagcagcgacgcctgctcatgagccgatccgagcgagatgaggcggaccttgaagaggcg
tcgaacgtgcaagtccactgccagatcggggtctatcaaggcgaactagttcgagagatt
cgagccactgtggtcaacaacctaagcgaacagaaggttcacaagatcacgggtgagtgg
gacgggtttggaagtctgaagcctgtgcacacgctggacgccggaaggagccacaccacg
aggctcacgctcgacagccccaggacccgaccaggaggacgggccgagctacgcctccca
ccgagcaagcatgccgagtgggctcaagcgcagcgcgcgaatgtgcggatcaagtacgag
atccgtggacagtggttcgagcgagtcggtgacgcgcctccggtccgcttcaaggcgccg
gcgctgcaggtctag

DBGET integrated database retrieval system