KEGG   Nocardioides sp. JS614: Noca_3568Help
Entry
Noca_3568         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4381 Phage_holin_5_2
Motif
Other DBs
NCBI-ProteinID: ABL83068
UniProt: A1SMN3
Position
complement(3784225..3784893)
Genome map
AA seq 222 aa AA seqDB search
MRPSVRTTRHSRTHRCKRSLRRYQPSTADGRPSGPHRAPVAHAEGPAVPHSGAGMTRRHR
ASAGMFASVGSTWIIPFLAPMVGAVAAFCLNRGSRLRRARTAALEDLQLHDRAKALLGAN
DPMIDQIKAHARESVRVYATRRAAHAKRLDAWLSAAAIIVTSLVLGTVIVALDLQDSWVL
LALGVIGGLVGIGTQGALERVQVGLALRKVPTEKSTRSPDAA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgaggccttcggtccgaacgactcgtcactcgcgaacgcatcggtgcaagaggtcgttg
cggcggtatcagccatcgacggctgacggaagaccgtctgggccccaccgcgcacccgtc
gcacacgcggaaggccccgccgtaccgcactcaggagccggtatgacgcggcgacatcgt
gcgagcgccggtatgttcgcgtccgtgggaagcacctggatcattcccttcctggcaccg
atggtcggcgccgtcgcggccttctgtctgaaccgcggatcccggcttcggcgtgcccgc
acagcggcgcttgaagaccttcagctgcacgaccgcgccaaggcgcttcttggtgccaac
gacccgatgatcgaccagatcaaggcgcatgcgcgcgaaagcgtccgggtgtacgcgact
cgccgcgccgcacatgcgaagcgactggatgcctggctttccgcggccgcgatcatcgtg
acctcgttggtcctcggaacagtcattgttgcgctcgacctccaggactcctgggttctt
ctcgcactgggtgtgatcggtggcctcgtcggcatcgggacccagggtgcactcgagcga
gtccaagtcggcctcgctctcaggaaggtccctacggagaagtccaccaggtcgccggac
gcggcatag

DBGET integrated database retrieval system