KEGG   Nocardioides sp. JS614: Noca_3572Help
Entry
Noca_3572         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABL83072
UniProt: A1SMN7
Position
3789653..3790357
Genome map
AA seq 234 aa AA seqDB search
MSEGITTNLEVSRQSVNVDVESIAPLRNFGEDSYDVANSTITAHVNVPAQGRYRLVLAME
TEEATSAFVRVVSATDQDFDTTATFKRIPQGQASILEPVLAKAGIPLEADVKAELEREVK
RYKVADIDLPAGPQVLRIHASQRVMPLGGDPRRYQFVIYAPQLSLAPTSNVRLGVTVVFP
LDFSANIDAPVVEALPNQPAVATDVFTDTMLGQQRAFGWAFHADPKITIGYTYP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagggaatcaccaccaacctcgaggtcagccggcagtcggtcaacgtcgacgtg
gagtcgatcgcgccgctgcggaacttcggcgaggactcctacgacgtcgcgaactccacg
atcacggcccacgtcaacgtgccagcgcagggcaggtaccggctggtgctggccatggag
accgaggaggcgacgtcggcgttcgtccgagtcgtctccgcgaccgaccaggacttcgac
acgaccgccacgttcaagcgaatcccgcagggacaggcgagcattctcgagcccgtcctc
gccaaggccggcatcccgctggaggccgacgtgaaggcggagctcgagcgcgaggtcaag
cggtacaaggtcgccgacatcgacctccccgccgggccgcaggtgctccgcatccacgcc
agccagcgcgtgatgcctctgggcggcgacccgcggcgctaccagttcgtcatctacgcg
ccgcagctcagcctcgcgccgacgtcgaacgtccgcctgggggtgacggtcgtgttcccg
ctcgacttcagcgccaatattgacgcgcccgtcgtggaggcgctgcccaaccagccggcc
gtcgcgaccgacgtgttcaccgacaccatgctcgggcagcagcgagccttcggatgggcg
ttccacgccgacccgaagatcaccatcgggtacacctacccgtag

DBGET integrated database retrieval system