KEGG   Nocardioides sp. JS614: Noca_3573Help
Entry
Noca_3573         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABL83073
UniProt: A1SMN8
Position
3790417..3792108
Genome map
AA seq 563 aa AA seqDB search
MGRCKFQSWTTACSSLDARSSQLRHSACVRATARTNRSRHAADQRPPARTPRLARPLAGH
ANATRRSNGFQPSFPQARHRLVFEALIEYSTDMSTDISDLDAAGVLAASGGALRRRRDAQ
VADLLLVLQWADLHGDDPQDRPGAVPVSHGGERLVELGGDGTPLVQDLCVHELAIARHTH
PVSTRATMGDALDLRHRLPLTWAQVVALECETWVACKVARMSRRLDRDQVGIVDRAVAEA
IGGESPGRVLAIAEAKVIEADTAAHAARFDDARRRRGVWVSRTDLETGSRTVFSRIEPGD
AAWIDAMTERIADALLARPDLLRAHHADLPAALDDLSHDELRAIAFGWLARPDDVCELLR
IGVDEVVPRKAHHRAVLYLHLHESALAGSSTAVARVEGLGPMLLEQVVSLLGHAHVTVKP
VIDLDDHVSVNAYEFPTAVTERTRLRCVGDVFPYAVGTATMSGRYDDDHAVPYDPLGPPG
QTGDHNDAPLARSHHRAKTHRGYRVRQIGDGAYLWTTPHGLRRLVDVGGTHELCASDAWR
LEHAEELDAAIQRMSDAMQAAAS
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgggtcggtgcaagttccagtcctggactaccgcatgctcatccctagatgcgcgcagt
tcgcagctgcgtcattccgcctgtgtccgcgcgactgcgcggaccaaccgcagccggcac
gccgccgaccagcgccccccggctcgaactccacggctcgcccggcccctggccggacac
gcgaacgcgacgcgtcgcagcaacgggttccagccatcgtttccacaagcacgccaccga
cttgttttcgaagctttgatcgaatatagtacagacatgtccactgacatcagcgacctc
gacgcggccggcgtgctggccgctagcggtggtgcgctgcgccggcggcgtgacgcgcag
gtggcggatctgctgctggtgctgcaatgggcggacctccacggcgacgacccgcaggac
cggccgggcgcggtgccggtgagtcacggcggcgagcggctggtcgagctcggcggcgac
ggcactcccctggttcaagacctgtgcgtgcacgagctcgcgatcgctcggcacacccat
cccgtctcgacccgggcaacgatgggcgatgcactcgacctgcggcaccgactgccgctg
acctgggcccaggtggtcgccctggagtgcgagacctgggtcgcctgcaaggtcgcgcgc
atgtcgcgccgcctcgaccgcgaccaggtcgggatcgtcgaccgagcggtggccgaggcg
atcggcggtgagtcgcccggccgcgtgctggcgatcgccgaggccaaggtcatcgaggcc
gacaccgccgcccacgcggcccggttcgacgacgctcggcgccgccgaggagtctgggtg
agccgcaccgacctcgagaccggcagccgcaccgtcttctcccgcatcgagcctggcgac
gccgcatggatcgacgcgatgaccgagcggatcgccgacgccctcctcgcccgccccgac
ctgctccgcgcccaccacgccgacctgccggccgccctggacgacctcagccacgacgag
ctgcgcgcgatcgccttcggctggctcgcgcgccccgacgacgtctgcgagctgctgcgc
atcggcgtcgacgaggtcgtcccgcgcaaggcgcaccaccgagccgtgctctacctccac
ctccacgagagcgccctggccggcagctccaccgccgtcgcccgggtcgagggactcgga
cccatgctcctcgaacaggtcgtgtcgcttctcggccacgcccacgtgaccgtcaagccg
gtgatcgacctcgacgaccacgtcagcgtcaatgcctacgagttccccaccgccgtgacc
gaacgcacccggctgcgctgcgtcggcgacgtcttcccgtacgccgtcggaaccgccacg
atgagcggccgctacgacgacgaccacgccgtcccctacgacccgctcggtccacccggg
cagaccggcgaccacaacgacgccccactcgcccgatcacaccaccgggccaagacccac
cgcggctaccgcgtcagacagatcggcgacggcgcctatctctggaccacacctcacggg
ctgcggcgactcgtcgacgtcggcggcacccacgagctctgcgcgagcgacgcctggcgg
ctcgagcacgccgaggagctcgacgccgccatccagcgcatgtccgacgccatgcaggcg
gctgcttcctga

DBGET integrated database retrieval system