KEGG   Nocardioides sp. JS614: Noca_3574Help
Entry
Noca_3574         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABL83074
UniProt: A1SMN9
Position
complement(3792140..3792676)
Genome map
AA seq 178 aa AA seqDB search
MADAGPDPTPDERDQTYDRWSRTQALSNRGYLIAAVVPFVIAAIGFGIVALVSSGDEAGS
GTTVRLPISGWAPTSGGGDDALIQGVLRLDDHYCVYLEAGQDGADPGKVWPVWPAGFKAT
REGDRLTLLDADGKVVAHDGDQVSMSGGFGPAGTFAGEPCVPASGEVAIVQSAVTVER
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
ttggctgacgccggccccgacccgacgcccgacgagcgggaccagacctacgaccgctgg
tcccgcacgcaggcgctgagcaaccgcgggtacctgatcgccgcggtcgtcccgttcgtg
atcgccgcgatcgggttcggcatcgtcgccctggtctcctccggcgacgaggccggcagc
ggcaccacggtccggctgccgatctccggttgggcgccgacgtccggtggcggcgacgat
gccctgatccagggcgtgctgcgcctcgacgaccactactgcgtctacctcgaggcgggc
caggacggggccgaccccgggaaggtgtggccggtctggccggcgggcttcaaggccacc
cgcgagggcgaccggctcacgctgctcgacgcggacggcaaggtcgtcgcccacgacggc
gaccaggtctcgatgagcggcggcttcggcccggccggcaccttcgccggcgagccgtgc
gtgccggcgagcggcgaggtcgcgatcgtgcagtccgcggtgacggtcgagcgctga

DBGET integrated database retrieval system