KEGG   Nocardioides sp. JS614: Noca_3584Help
Entry
Noca_3584         CDS       T00443                                 

Definition
(GenBank) formyltetrahydrofolate-dependent phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00230  Purine metabolism
nca00670  One carbon pool by folate
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01130  Biosynthesis of antibiotics
Module
nca_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Noca_3584
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Noca_3584
Enzymes [BR:nca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     Noca_3584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N
Motif
Other DBs
NCBI-ProteinID: ABL83084
UniProt: A1SMP9
Position
complement(3801758..3802384)
Genome map
AA seq 208 aa AA seqDB search
MTPRRPARLVVLVSGSGTNLQALLDACADPSYGARVVAVGADRDDIEGLARADRAGVPTF
VRKVGQFTSREHWDRALADTVAGFEPDLVVLAGFMKLVGAEFLTRLGGRVVNTHPALSPS
FPGMHGPADALAYGVKVTGCTLFVVDDGVDTGPIVAQRAVPVEDDDTVETLHERIKVAER
AMLVDTVGRMARAGWTVEGRRTRFGDET
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccacgccgccccgctcgtctcgtggtgctcgtgtccgggtccgggaccaacctc
caggcgttgctcgacgcgtgcgccgacccgtcgtacggcgcccgcgtcgtcgccgtgggc
gccgaccgcgacgacatcgagggactcgcccgcgcggatcgggccggcgtgccgacgttc
gtgcggaaggtcgggcagttcaccagccgcgagcactgggaccgggccctcgcggacacg
gtcgccggcttcgagcccgacctggtcgtgcttgccgggttcatgaagctggtgggggcc
gagttcctgacccggctcggcggccgggtcgtcaacacccaccccgcgctgtccccgtcc
ttccccggcatgcacggtccggccgatgccctcgcgtacggcgtcaaggtgaccgggtgc
acgctgttcgtggtcgacgacggggtcgacaccggcccgatcgtcgcccagcgagccgtg
ccggtcgaggacgacgacaccgtcgagacgctgcacgagcggatcaaggtcgccgagcgc
gcgatgctggtcgacacggtcggccggatggcccgggccggctggaccgtcgagggccgg
cgcactcggttcggtgacgagacctga

DBGET integrated database retrieval system