KEGG   Nocardioides sp. JS614: Noca_3587Help
Entry
Noca_3587         CDS       T00443                                 

Definition
(GenBank) Sigma-70, region 4 type 2
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
nca  Nocardioides sp. JS614
Brite
Transcription machinery [BR:nca03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Noca_3587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r2 Sigma70_r4 HTH_AsnC-type HTH_23 Sigma70_ECF TPR_2 TPR_12 ADSL_C
Motif
Other DBs
NCBI-ProteinID: ABL83087
UniProt: A1SMQ2
Position
3805966..3806478
Genome map
AA seq 170 aa AA seqDB search
MDELEFDEFYSASFQRIVGQVYAMIGNRDEAQECVQEAFARAWAHRRKLDRAEHPEAWVR
TTAYRLAVSRWRRTARGRRPVDRALGAPTETAPPSEAHVALVAALKQLPEAQRQALVLHH
IADLPVHDVAREVGVPEGTIKARLSRGRAALAAMLADERPGGLQEGASHA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggacgagctcgagttcgacgagttctacagcgcgtcgttccaacgcatcgtgggccag
gtctacgcgatgatcggcaaccgtgacgaggcacaggagtgcgtccaggaggcgttcgcg
cgggcctgggcgcaccgacgcaagctggaccgcgcggagcaccccgaggcgtgggtgcgg
accacggcgtaccgcctggcggtgagccgctggcggcgtacggcgcggggccgcaggccg
gtcgaccgggccctcggcgcgcccaccgagacggcgccgccgagcgaggcacacgtcgcg
ctggtggccgcgctcaagcagctccccgaggcgcagcgacaggcgttggtcctgcaccac
atcgccgacctccccgtccacgacgtcgcccgtgaggtcggcgtccccgagggcaccatc
aaggcccggctcagccgcggccgcgcggcgctcgccgcgatgctcgccgacgaacgaccc
ggcggtctccaggaaggagcgagccatgcgtga

DBGET integrated database retrieval system