KEGG   Nocardioides sp. JS614: Noca_3590Help
Entry
Noca_3590         CDS       T00443                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00020  Citrate cycle (TCA cycle)
nca00640  Propanoate metabolism
nca00660  C5-Branched dibasic acid metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01120  Microbial metabolism in diverse environments
nca01130  Biosynthesis of antibiotics
nca01200  Carbon metabolism
Module
nca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Noca_3590
   00640 Propanoate metabolism
    Noca_3590
   00660 C5-Branched dibasic acid metabolism
    Noca_3590
Enzymes [BR:nca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Noca_3590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABL83090
UniProt: A1SMQ5
Position
complement(3808449..3809609)
Genome map
AA seq 386 aa AA seqDB search
MDLMEYQAKELFAKHDVPVTLGIVAHTPDEAQAAAEQLGVVVVKAQVKAGGRGKAGGVKL
AKTPEEARTHAEAILGMEIKGLRVNRVLIAPAASIEEEYYFSFLLDRANRRYLCIASVEG
GVEIEEVAKTNPDAVRQIPIDPGAGVDEAKAREIVADAKFPEALTEQAVQTVLALWKVFV
EEDATLVEVNPLARLAGDKLEALDGKVSLDENAEFRHEEHASFVIREEEDPLESAAKDKG
LNYVKLDGSVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGANAQVMADGLHV
ILGDEQVKAVFVNVFGGITACDEVANGIVGALDILGEDATKPLVIRLDGNNADEGRRILT
EAAHPLVTMVDTMDGAADKAAELANA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtggatctgatggagtaccaggcgaaggagctcttcgccaagcacgacgtaccggtcact
ctcggcatcgtcgcccacacccccgacgaggcccaggccgctgctgagcagctgggtgtc
gtggtggtcaaggcgcaggtgaaggccggtggccgcggcaaggcgggcggcgtcaagctc
gccaagacgcccgaggaggctcgcacgcacgccgaggcgatcctcggcatggagatcaag
ggcctccgcgtgaaccgcgtgctcatcgctcccgccgccagcatcgaggaggagtactac
ttctcgttcctgctcgaccgggccaaccgtcgctacctgtgcatcgccagcgtcgagggc
ggcgtggagatcgaggaggtcgccaagaccaaccccgacgccgtgcgccagatcccgatc
gacccgggcgccggtgtcgacgaggccaaggctcgggagatcgtcgccgacgcgaagttc
cccgaggcgctgaccgagcaggccgtgcagaccgtgctcgcgctctggaaggtcttcgtc
gaggaggacgccacgctggtcgaggtcaacccgctcgcgcggctggccggcgacaagctc
gaggcgctcgacggcaaggtctcgctcgacgagaacgccgagttccgccacgaggagcac
gcctccttcgtgatccgcgaggaggaggacccgctcgagtccgccgccaaggacaagggc
ctgaactacgtcaagctcgacggctcggtcgggatcatcggcaacggcgccggtctggtc
atgtccacgctcgacgtcgtcgcgtatgccggtgagaagcacggtggggtcaagcccgcg
aacttcctcgacatcggtggcggcgccaacgcccaggtgatggccgacggcctgcacgtg
atcctcggcgacgagcaggtcaaggccgtgttcgtgaacgtgttcggcgggatcaccgcc
tgcgacgaggtcgccaacggcatcgtcggcgccctggacatcctcggtgaggatgccacc
aagccgctggtcatccggctcgacggcaacaatgccgacgaaggccgccggatcctcacc
gaggcggcccaccctctcgtgaccatggtggacacgatggacggcgcggccgacaaggcc
gccgagctcgcgaacgcctga

DBGET integrated database retrieval system